KEGG   Escherichia coli K-12 W3110: JW4066
Entry
JW4066            CDS       T00068                                 

Gene name
phnD
Definition
(GenBank) phosphonate/organophosphate ester transporter subunit
  KO
K02044  phosphonate transport system substrate-binding protein
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    JW4066 (phnD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW4066 (phnD)
Transporters [BR:ecj02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    JW4066 (phnD)
SSDB
Motif
Pfam: Phosphonate-bd SBP_bac_3 YukC NMT1_3
Other DBs
NCBI-ProteinID: BAE78107
UniProt: P16682
Structure
PDB: 
3P7I 3QUJ 3QK6 3S4U

Position
complement(4328014..4329030)
AA seq 338 aa
MNAKIIASLAFTSMFSLSTLLSPAHAEEQEKALNFGIISTESQQNLKPQWTPFLQDMEKK
LGVKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDRANGQVFAQTVAADGSPGYW
SVLIVNKDSPINNLNDLLAKRKDLTFGNGDPNSTSGFLVPGYYVFAKNNISASDFKRTVN
AGHETNALAVANKQVDVATNNTENLDKLKTSAPEKLKELKVIWKSPLIPGDPIVWRKNLS
ETTKDKIYDFFMNYGKTPEEKAVLERLGWAPFRASSDLQLVPIRQLALFKEMQGVKSNKG
LNEQDKLAKTTEIQAQLDDLDRLNNALSAMSSVSKAVQ
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgaacgctaagataattgcctcgctggccttcaccagcatgttcagcctcagcaccctg
ttaagcccggcgcacgccgaagagcaggaaaaggcgttgaatttcggcattatttcaacg
gaatcacagcaaaacctgaaaccgcaatggacgccgttcttgcaggatatggagaagaag
ctgggcgtgaaggtcaacgccttctttgccccggactacgcgggcattatccaggggatg
cgcttcaataaagtggatatcgcctggtacggcaatctgtcggcgatggaagcggtggat
cgcgccaatggccaggtcttcgcccagacggtcgcggcggatggatcgccgggttactgg
agcgtgttgatcgtcaacaaagacagtccgatcaacaacctgaacgatctgctggcgaag
cggaaagatctcacctttggcaatggcgatcctaactccacctctggcttcctcgtcccc
ggctactacgtcttcgccaaaaacaatatctccgccagcgacttcaagcgcaccgtcaac
gccgggcatgaaaccaacgcgctggccgtcgccaacaagcaggtggatgttgccaccaac
aacaccgaaaacctcgacaagctgaaaacctccgcgccagagaagctgaaagaactgaag
gtgatctggaagtcgccgctgatcccaggcgatccgatcgtctggcgcaagaatctttcc
gaaaccaccaaagacaagatctacgacttctttatgaactacggcaaaacgccggaagaa
aaagcggtgctggaacgcctgggctgggcgccattccgcgcttccagcgacctgcaactg
gtgccgattcgccagctcgcgctgtttaaagagatgcagggcgtgaaaagcaataaagga
ctgaatgagcaggacaagctggcaaaaaccaccgagattcaggcgcagctggatgacctg
gaccgcctgaacaacgcgctaagcgcgatgagttcggtgagtaaagcggtgcagtaa

DBGET integrated database retrieval system