KEGG   Escherichia coli K-12 W3110: JW4067
Entry
JW4067            CDS       T00068                                 

Gene name
phnC
Definition
(GenBank) phosphonate/organophosphate ester transporter subunit
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    JW4067 (phnC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW4067 (phnC)
Enzymes [BR:ecj01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     JW4067 (phnC)
Transporters [BR:ecj02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    JW4067 (phnC)
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_16 AAA_29 RsgA_GTPase SMC_N AAA_23 AAA_30 AAA_22 MMR_HSR1 Mg_chelatase AAA_5 NACHT AAA_18 AAA_25 AAA_28 AAA_33 SbcCD_C PhoH PRK Rad17 AAA_7 TsaE G-alpha AAA_19 AAA_24 cobW RNA_helicase
Other DBs
NCBI-ProteinID: BAE78108
UniProt: P16677
Position
complement(4329055..4329843)
AA seq 262 aa
MQTIIRVEKLAKTFNQHQALHAVDLNIHHGEMVALLGPSGSGKSTLLRHLSGLITGDKSV
GSHIELLGRTVQREGRLARDIRKSRAHTGYIFQQFNLVNRLSVLENVLIGALGSTPFWRT
CFSWFTGEQKQRALQALTRVGMVHFAHQRVSTLSGGQQQRVAIARALMQQAKVILADEPI
ASLDPESARIVMDTLRDINQNDGITVVVTLHQVDYALRYCERIVALRQGHVFYDGSSQQF
DNERFDHLYRSINRVEENAKAA
NT seq 789 nt   +upstreamnt  +downstreamnt
atgcaaacgattatccgtgtcgagaagctcgccaaaaccttcaatcagcatcaggcgctg
catgcggttgatctgaacattcatcacggtgaaatggtggctctgcttgggccgtcgggt
tccggaaaatccacccttttacgtcacttaagcggtttgattaccggcgataaatctgtc
ggtagccatatcgagctgctgggccgcacagtccagcgcgaaggccgcctggcccgcgat
atccgcaaaagccgcgcccataccggctacatattccaacaattcaacctggtgaaccgc
ctgagcgtactggagaacgtgctgattggcgcgctcggcagcacgccgttctggcgcacc
tgttttagctggttcaccggcgagcagaaacagcgcgcgttacaggcgctgacccgcgtt
ggcatggtgcattttgcccatcagcgcgtttccaccctctccggcggccagcagcaacgt
gtggcgattgcccgtgcgctgatgcagcaggcgaaagtgattctggccgatgaacccatc
gcctcgctggacccagaatcagcgcgcatcgtgatggacaccctgcgcgacatcaaccag
aacgacggcatcaccgtggtcgtcacgctgcatcaggtggattacgccctgcgctactgc
gaacgcatcgtcgccctgcgccaggggcacgtcttctacgacggcagcagccaacagttt
gataacgaacgttttgaccatctctaccgcagcattaaccgcgtcgaagagaacgcgaaa
gctgcctga

DBGET integrated database retrieval system