KEGG   Escherichia coli K-12 W3110: JW4079
Entry
JW4079            CDS       T00068                                 

Gene name
melR
Definition
(GenBank) DNA-binding transcriptional dual regulator
  KO
K23237  AraC family transcriptional regulator, melibiose operon regulatory protein
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecj03000]
    JW4079 (melR)
Transcription factors [BR:ecj03000]
 Prokaryotic type
  Helix-turn-helix
   AraC family
    JW4079 (melR)
SSDB
Motif
Pfam: HTH_AraC HTH_18 Cupin_2 Bac_A_amyl_C
Other DBs
NCBI-ProteinID: BAE78120
UniProt: P0ACH8
Position
complement(4345398..4346306)
AA seq 302 aa
MNTDTFMCSSDEKQTRSPLSLYSEYQRMEIEFRAPHIMPTSHWHGQVEVNVPFDGDVEYL
INNEKVNINQGHITLFWACTPHQLTDTGTCQSMAIFNLPMHLFLSWPLDKDLINHVTHGM
VIKSLATQQLSPFEVRRWQQELNSPNEQIRQLAIDEIGLMLKRFSLSGWEPILVNKTSRT
HKNSVSRHAQFYVSQMLGFIAENYDQALTINDVAEHVKLNANYAMGIFQRVMQLTMKQYI
TAMRINHVRALLSDTDKSILDIALTAGFRSSSRFYSTFGKYVGMSPQQYRKLSQQRRQTF
PG
NT seq 909 nt   +upstreamnt  +downstreamnt
atgaatacagatacgtttatgtgcagcagcgacgaaaaacagacccgcagcccgctgtcg
ctgtattcggaataccagcggatggagattgagtttcgcgcaccgcatatcatgcccacc
agccactggcatggtcaggtcgaagtgaatgtgcctttcgatggcgatgtggaatacctg
atcaacaatgaaaaagtgaatatcaatcagggtcatatcacgctgttctgggcctgtaca
ccgcaccaactaacagataccggaacctgtcagagcatggcgatttttaatctgccgatg
catctgtttctctcctggccgctggataaagacctgattaaccacgtcactcacggcatg
gtgatcaaatcactggccacacagcaacttagcccgtttgaagtgcgccgctggcagcag
gaattaaacagtccgaacgagcaaattcgccagctcgccattgatgaaattggcctgatg
ctcaagcgatttagcctctctggctgggaaccgattctggtcaataaaacctcgcgcaca
cacaaaaacagcgtctcgcgccatgcgcaattttatgttagccagatgctgggctttatt
gccgaaaactatgatcaggcgctgaccatcaacgatgtggctgagcacgtcaaacttaac
gccaactatgcaatggggatattccagcgggtcatgcaattgacgatgaaacagtacatt
accgcgatgcgcatcaaccacgttcgcgcgttactgagcgataccgataaaagtattctc
gatattgccctgacggcaggctttcgttcaagtagtcgtttttacagcacgttcggcaaa
tatgtcggcatgtcgccgcaacaataccgcaaacttagccaacagcgccgccagacgttt
cccggctaa

DBGET integrated database retrieval system