KEGG   Escherichia coli K-12 W3110: JW4101
Entry
JW4101            CDS       T00068                                 

Symbol
yjeH
Name
(GenBank) predicted transporter
  KO
K16263  amino acid efflux transporter
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW4101 (yjeH)
Transporters [BR:ecj02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   JW4101 (yjeH)
SSDB
Motif
Pfam: AA_permease_2 AA_permease
Other DBs
NCBI-ProteinID: BAE78143
UniProt: P39277
Position
complement(4373836..4375092)
AA seq 418 aa
MSGLKQELGLAQGIGLLSTSLLGTGVFAVPALAALVAGNNSLWAWPVLIILVFPIAIVFA
ILGRHYPSAGGVAHFVGMAFGSRLERVTGWLFLSVIPVGLPAALQIAAGFGQAMFGWHSW
QLLLAELGTLALVWYIGTRGASSSANLQTVIAGLIVALIVAIWWAGDIKPANIPFPAPGN
IELTGLFAALSVMFWCFVGLEAFAHLASEFKNPERDFPRALMIGLLLAGLVYWGCTVVVL
HFDAYGEKMAAAASLPKIVVQLFGVGALWIACVIGYLACFASLNIYIQSFARLVWSQAQH
NPDHYLARLSSRHIPNNALNAVLGCCVVSTLVIHALEINLDALIIYANGIFIMIYLLCML
AGCKLLQGRYRLLAVVGGLLCVLLLAMVGWKSLYALIMLAGLWLLLPKRKTPENGITT
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgagtggactcaaacaagaactggggctggcccagggcattggcctgctatcgacgtca
ttattaggcactggcgtgtttgccgttcctgcgttagctgcgctggtagcgggcaataac
agcctgtgggcgtggcccgttttgattatcttagtgttcccgattgcgattgtgtttgcg
attctgggtcgccactatcccagcgcaggcggcgtcgcgcacttcgtcggtatggcgttt
ggttcgcggcttgagcgagtcaccggctggctgtttttatcggtcattcccgtgggtttg
cctgccgcactacaaattgccgccgggttcggccaggcgatgtttggctggcatagctgg
caactgttgttggcagaactcggtacgctggcgctggtgtggtatatcggtactcgcggt
gccagttccagtgctaatctacaaaccgttattgccggacttatcgtcgcgctgattgtc
gctatctggtgggcgggcgatatcaaacctgcgaatatcccctttccggcacctggtaat
atcgaacttaccgggttatttgctgcgttatcagtgatgttctggtgttttgtcggtctg
gaggcatttgcccatctcgcctcggaatttaaaaatccagagcgtgattttcctcgtgct
ttgatgattggtctgctgctggcaggattagtctactggggctgtacggtagtcgtctta
cacttcgacgcctatggtgaaaaaatggcggcggcagcatcgcttccaaaaattgtagtg
cagttgttcggtgtaggagcgttatggattgcctgcgtgattggctatctggcctgcttt
gccagtctcaacatttatatacagagcttcgcccgcctggtctggtcgcaggcgcaacat
aatcctgaccactacctggcacgcctctcttctcgccatatcccgaataatgccctcaat
gcggtgctcggctgctgtgtggtgagcactttggtgattcatgctttagagatcaatctg
gacgctcttattatttatgccaatggcatctttattatgatttatctgttatgcatgctg
gcaggctgtaaattattgcaaggacgttatcgactactggcggtggttggcgggctgtta
tgcgttctgttactggcaatggtcggctggaaaagtctctatgcgctgatcatgctggcg
gggttatggctgttgctgccaaaacgaaaaacgccggaaaatggcataaccacataa

DBGET integrated database retrieval system