KEGG   Escherichia coli K-12 W3110: JW4120
Entry
JW4120            CDS       T00068                                 

Symbol
yjeP
Name
(GenBank) predicted mechanosensitive channel
  KO
K22051  miniconductance mechanosensitive channel
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW4120 (yjeP)
Transporters [BR:ecj02000]
 Other transporters
  Pores ion channels [TC:1]
   JW4120 (yjeP)
SSDB
Motif
Pfam: MscS_TM MS_channel MscS_porin
Other DBs
NCBI-ProteinID: BAE78163
UniProt: P39285
Position
complement(4390727..4394050)
AA seq 1107 aa
MRLIITFLMAWCLSWGAYAATAPDSKQITQELEQAKAAKPAQPEVVEALQSALNALEERK
GSLERIKQYQQVIDNYPKLSATLRAQLNNMRDEPRSVSPGMSTDALNQEILQVSSQLLDK
SRQAQQEQERAREIADSLNQLPQQQTDARRQLNEIERRLGTLTGNTPLNQAQNFALQSDS
ARLKALVDELELAQLSANNRQELARLRSELAEKESQQLDAYLQALRNQLNSQRQLEAERA
LESTELLAENSADLPKDIVAQFKINRELSAALNQQAQRMDLVASQQRQAASQTLQVRQAL
NTLREQSQWLGSSNLLGEALRAQVARLPEMPKPQQLDTEMAQLRVQRLRYEDLLNKQPLL
RQIHQADGQPLTAEQNRILEAQLRTQRELLNSLLQGGDTLLLELTKLKVSNGQLEDALKE
VNEATHRYLFWTSDVRPMTIAWPLEIAQDLRRLISLDTFSQLGKASVMMLTSKETILPLF
GALILVGCSIYSRRYFTRFLERSAAKVGKVTQDHFWLTLRTLFWSILVASPLPVLWMTLG
YGLREAWPYPLAVAIGDGVTATVPLLWVVMICATFARPNGLFIAHFGWPRERVSRGMRYY
LMSIGLIVPLIMALMMFDNLDDREFSGSLGRLCFILICGALAVVTLSLKKAGIPLYLNKE
GSGDNITNHMLWNMMIGAPLVAILASAVGYLATAQALLARLETSVAIWFLLLVVYHVIRR
WMLIQRRRLAFDRAKHRRAEMLAQRARGEEEAHHHSSPEGAIEVDESEVDLDAISAQSLR
LVRSILMLIALLSVIVLWSEIHSAFGFLENISLWDVTSTVQGVESLEPITLGAVLIAILV
FIITTQLVRNLPALLELAILQHLDLTPGTGYAITTITKYLLMLIGGLVGFSMIGIEWSKL
QWLVAALGVGLGFGLQEIFANFISGLIILFEKPIRIGDTVTIRDLTGSVTKINTRATTIS
DWDRKEIIVPNKAFITEQFINWSLSDSVTRVVLTIPAPADANSEEVTEILLTAARRCSLV
IDNPAPEVFLVDLQQGIQIFELRIYAAEMGHRMPLRHEIHQLILAGFHAHGIDMPFPPFQ
MRLESLNGKQTGRTLTSAGKGRQAGSL
NT seq 3324 nt   +upstreamnt  +downstreamnt
gtgcgcctgattatcacttttctgatggcctggtgcctcagttggggggcgtacgccgcg
acggcccccgatagcaaacaaatcactcaggaactggagcaggcaaaagcggcgaaaccc
gcacagccggaagtcgtagaggcgctccagtctgccttaaatgcgcttgaggaacgaaaa
ggttcccttgagcgcatcaaacaatatcagcaagttatcgataattatccgaaactctcc
gctactctgcgcgcacaattaaacaacatgcgtgacgagccgcgcagcgtgtcgccggga
atgtctaccgacgcgctgaatcaggaaattctccaggtcagcagccagttgctggataaa
agccgtcaggcccagcaagagcaggagcgcgcccgcgagattgccgattcgctgaatcaa
ctgccgcaacagcaaaccgacgcccgccgtcagttaaatgagatcgagcgccgcctggga
acgcttaccggcaatactccgctcaatcaggcacaaaatttcgcgttgcagtctgactct
gcacgtcttaaggcgctcgttgatgaactggagctggcgcagctgtctgccaataaccgc
caggaattagcgcgcttacgctcagagctggcggaaaaagagagccagcaactggatgcg
tatttgcaggccttgcgtaatcaattaaacagccaacgtcagcttgaggcggagcgggcg
ctggaaagtaccgaattgctggcagaaaacagcgccgatttgccgaaagatatcgtcgcg
caattcaaaattaaccgcgaactatcggcggctttgaatcaacaggcgcagcggatggat
ctcgttgcctcgcaacagcgtcaggctgccagccagacgttacaggtccggcaggcgttg
aatacgctgcgtgaacagtcgcaatggctgggatcgtccaatctgctcggcgaagcgctg
cgggcgcaggtggcacggctgccggaaatgccgaaaccacaacagcttgataccgaaatg
gcgcagttgcgtgtgcaacggttacgttatgaggatctgcttaataaacagccgctgcta
cggcaaattcatcaggccgacggtcagccgctgactgccgagcaaaaccgtattctggaa
gcacaactgcgcactcagcgtgagttgctgaactcattgttgcagggtggcgacacgcta
ctattggaactgaccaagctgaaagtctccaacgggcaactggaggatgcgctgaaagag
gtgaacgaagcaacgcaccgctatctgttctggacctctgacgtgcgcccgatgaccatc
gcctggccgctggaaatcgcccaggatctgcgtcgtctcatttcgctggacaccttcagt
cagttgggcaaagccagtgtgatgatgctgaccagcaaagagacaattttgccgctgttt
ggcgcgttgattctggtcggttgcagtatttactcgcgccgctatttcacccgttttctt
gaacgttcggcggcgaaagttggcaaagtgactcaggatcacttctggctgacgttgcgc
actcttttctggtcgattctcgtcgcgtcaccgttaccggtgctgtggatgacgctgggt
tacggcttgcgcgaggcgtggccttatccgctggcggtcgcgattggcgatggtgtaacg
gccaccgtgccgctgctgtgggtagtgatgatttgcgccacctttgcccgcccgaacggc
ttgtttatcgctcattttggctggccgcgcgaacgtgtttcccgtgggatgcgctactac
ctgatgagcatcgggcttattgtgccgctgattatggcgctgatgatgttcgataacctc
gacgaccgtgaattctccggttcgctgggacggctttgctttatcctcatttgcggtgcg
ctggcggtggtcaccctcagcctgaaaaaggccgggattccgctgtatctcaacaaagag
ggcagcggcgacaacattaccaaccatatgctgtggaacatgatgattggcgcgccgttg
gttgccattctggcgtcggcggtgggttatctggcaacggcacaggcgctgttagcgagg
cttgaaacctcggttgccatctggttcctgctactggtggtttatcacgttatccgccgc
tggatgctgatccagcgccgcaggctggcgtttgatcgggcgaagcatcgccgggcagag
atgttagcgcaacgtgcgcgtggcgaagaggaagcgcatcatcacagtagcccggaagga
gcaattgaagtcgatgaaagcgaagtcgatctcgatgccatcagtgcgcaatccttgcgg
ctggtgcgctcaattttgatgttgatcgccctgctttctgtcattgtgctgtggtcagaa
atccattccgctttcggcttcctcgaaaatatttcgctgtgggatgtcacctccacggta
cagggcgtagaaagtctggagccaattaccctcggtgcggtgctgattgccattctggtg
tttatcatcaccacgcagctggtgcgcaacttgcccgcgctgctggaactggcgattttg
cagcacctggatttaacgccgggtacgggttacgccatcaccaccatcaccaaatatctg
ctgatgctgattggcgggctggtcggcttctcaatgattggtattgagtggtcgaaattg
cagtggctggttgccgcgctcggtgttggtctcggttttggtttgcaggaaattttcgcc
aactttatctctggtctgattatcctgttcgaaaaaccgattcgcattggcgatacggtg
acaattcgcgatctcaccggtagcgtgacgaaaattaacacccgcgccaccaccatcagc
gactgggaccgtaaagagataatcgtgccgaacaaggcgtttattaccgagcagtttatc
aactggtcgctctctgactcggtcacgcgcgtggtgttgacgataccggcccctgccgat
gccaatagcgaagaagtgacggaaatcctgctcaccgcagcgcgtcgctgctcgctggtg
atcgacaacccggcaccggaagtcttcctggtggatctgcaacaggggattcagattttc
gagctgcgtatttacgccgctgagatgggtcaccgtatgccgctacgccatgagatccac
cagctgattctggctggcttccatgcccacggtatcgatatgccattcccgcccttccag
atgcgtctggaaagcctcaacggtaaacaaacggggagaacgctgacgtctgcgggcaaa
ggtcgtcaggcgggaagtttgtaa

DBGET integrated database retrieval system