KEGG   Escherichia coli K-12 W3110: JW4160Help
Entry
JW4160            CDS       T00068                                 

Gene name
rpsR
Definition
(GenBank) 30S ribosomal subunit protein S18
  KO
K02963  small subunit ribosomal protein S18
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj03010  Ribosome
Module
ecj_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    JW4160 (rpsR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ecj03011]
    JW4160 (rpsR)
Ribosome [BR:ecj03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    JW4160 (rpsR)
  Bacteria
    JW4160 (rpsR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S18
Motif
Other DBs
NCBI-ProteinID: BAE78203
UniProt: P0A7T7
Structure
PDB: 

Position
4430519..4430746
Genome map
AA seq 75 aa AA seqDB search
MARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIK
RARYLSLLPYTDRHQ
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atggcacgttatttccgtcgtcgcaagttctgccgtttcaccgcggaaggcgttcaagag
atcgactataaagatatcgctacgctgaaaaactacatcaccgaaagcggtaagattgtc
ccaagccgtatcaccggtacccgtgcaaaataccagcgtcagctggctcgcgctatcaaa
cgcgctcgctacctgtccctgctgccgtacactgatcgccatcagtaa

DBGET integrated database retrieval system