KEGG   Escherichia coli K-12 W3110: JW4166
Entry
JW4166            CDS       T00068                                 

Symbol
cycA
Name
(GenBank) D-alanine/D-serine/glycine transporter
  KO
K11737  D-serine/D-alanine/glycine transporter
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW4166 (cycA)
Transporters [BR:ecj02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   JW4166 (cycA)
SSDB
Motif
Pfam: AA_permease AA_permease_2 DUF6203
Other DBs
NCBI-ProteinID: BAE78209
UniProt: P0AAE0
Position
4434544..4435956
AA seq 470 aa
MVDQVKVVADDQAPAEQSLRRNLTNRHIQLIAIGGAIGTGLFMGSGKTISLAGPSIIFVY
MIIGFMLFFVMRAMGELLLSNLEYKSFSDFASDLLGPWAGYFTGWTYWFCWVVTGMADVV
AITAYAQFWFPDLSDWVASLAVIVLLLTLNLATVKMFGEMEFWFAMIKIVAIVSLIVVGL
VMVAMHFQSPTGVEASFAHLWNDGGWFPKGLSGFFAGFQIAVFAFVGIELVGTTAAETKD
PEKSLPRAINSIPIRIIMFYVFALIVIMSVTPWSSVVPEKSPFVELFVLVGLPAAASVIN
FVVLTSAASSANSGVFSTSRMLFGLAQEGVAPKAFAKLSKRAVPAKGLTFSCICLLGGVV
MLYVNPSVIGAFTMITTVSAILFMFVWTIILCSYLVYRKQRPHLHEKSIYKMPLGKLMCW
VCMAFFVFVVVLLTLEDDTRQALLVTPLWFIALGLGWLFIGKKRAAELRK
NT seq 1413 nt   +upstreamnt  +downstreamnt
atggtagatcaggtaaaagtcgttgccgatgatcaggctccggctgaacagtcgctacgg
cgcaatctcacaaaccgacatattcagcttattgccattggcggtgccattggtacgggg
ttgtttatggggtctggcaaaacgattagccttgccgggccgtcgatcattttcgtttat
atgatcattggttttatgctctttttcgtgatgcgggcaatgggggaattgctgctttcg
aatctggaatacaaatcttttagtgacttcgcttccgatttactcgggccgtgggcagga
tatttcaccggctggacttactggttctgctgggttgtaaccggtatggcagacgtggtg
gcgatcacggcttatgctcagttctggttccccgatctctccgactgggtcgcctcgctg
gcggtgatagtgctgctgctgacgctcaatctcgccaccgtgaaaatgttcggtgagatg
gagttctggtttgcgatgatcaaaatcgtcgccattgtgtcgctgattgtcgtcggcctg
gtcatggtggcgatgcactttcagtcaccgactggtgtggaagcgtcattcgcgcatttg
tggaatgacggcggctggttcccgaaaggtttaagtggcttctttgccggattccagata
gcggttttcgctttcgtggggattgagctggtaggtacaacagctgcggaaaccaaagat
ccagagaaatcactgccacgcgcgattaactccattccgatccgtatcattatgttctac
gtcttcgcgctgattgtgattatgtccgtgacgccgtggagttcggtagtcccggagaaa
agcccgtttgttgaactgttcgtgttggtagggctgcctgctgccgcaagcgtgatcaac
tttgtggtgctgacctctgcggcgtcttccgctaacagcggcgtcttctctaccagccgt
atgctgtttggtctggcgcaggaaggtgtggcaccgaaagcgttcgctaaactttctaag
cgcgcagtacccgcgaaagggctgacgttctcgtgtatctgtctgctcggcggcgtggtg
atgttgtatgtgaatcctagtgtgattggcgcgttcacgatgattacaaccgtttccgcg
attctgtttatgttcgtctggacgattatcctttgctcgtaccttgtgtatcgcaaacag
cgtcctcatctacatgagaagtcgatctacaagatgccgctcggcaagctgatgtgctgg
gtatgtatggcgttctttgtgttcgtggtcgtgttgctgacactggaagatgacactcgc
caggcgctgctggttaccccgctgtggtttatcgcgctggggttgggctggctgtttatt
ggtaagaagcgggctgctgaactgcggaaataa

DBGET integrated database retrieval system