KEGG   Escherichia coli K-12 W3110: JW4223Help
Entry
JW4223            CDS       T00068                                 

Gene name
idnO
Definition
(GenBank) 5-keto-D-gluconate-5-reductase
  KO
K00046  gluconate 5-dehydrogenase [EC:1.1.1.69]
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    JW4223 (idnO)
Enzymes [BR:ecj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.69  gluconate 5-dehydrogenase
     JW4223 (idnO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR DUF1776 DUF5405
Motif
Other DBs
NCBI-ProteinID: BAE78263
UniProt: P0A9P9
Position
complement(4497267..4498031)
Genome map
AA seq 254 aa AA seqDB search
MNDLFSLAGKNILITGSAQGIGFLLATGLGKYGAQIIINDITAERAELAVEKLHQEGIQA
VAAPFNVTHKHEIDAAVEHIEKDIGPIDVLVNNAGIQRRHPFTEFPEQEWNDVIAVNQTA
VFLVSQAVTRHMVERKAGKVINICSMQSELGRDTITPYAASKGAVKMLTRGMCVELARHN
IQVNGIAPGYFKTEMTKALVEDEAFTAWLCKRTPAARWGDPQELIGAAVFLSSKASDFVN
GHLLFVDGGMLVAV
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatctattttcactggcaggaaaaaatatcttgattaccggttcagcacagggc
attggctttttactggcaaccggcctgggtaaatatggcgcacaaataattattaatgat
attactgccgaacgcgcagaacttgctgtagaaaaactccaccaggagggtattcaggcc
gttgccgcaccttttaatgttactcataaacatgaaattgatgccgccgttgaacatatc
gaaaaggacatcggccccattgatgtgctggtgaataacgccggtatccagcgccgtcat
ccttttactgagttccctgaacaagagtggaatgatgtgatcgcagtaaaccagaccgcc
gtgttcctggtatcgcaagcggtaactcgtcacatggttgaacgcaaggcaggtaaagtt
attaatatttgctcgatgcaaagcgaactgggacgtgacaccatcaccccttatgccgca
tcgaaaggggcggtaaaaatgctcacccgcggcatgtgcgtcgagctggcgcgccacaat
attcaggtcaacggtattgcgccgggctatttcaaaacagaaatgactaaagcactggtt
gaggacgaagccttcaccgcctggttgtgcaaacggacccccgccgcacgctggggagat
ccgcaggaactgattggtgctgcggtgttcctttcttcaaaagcctctgatttcgtaaac
ggccacctgttgtttgttgatggcggcatgttagtggctgtttaa

DBGET integrated database retrieval system