KEGG   Escherichia coli K-12 W3110: JW4283
Entry
JW4283            CDS       T00068                                 

Symbol
fimH
Name
(GenBank) minor component of type 1 fimbriae
  KO
K07350  minor fimbrial subunit
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecj02044]
    JW4283 (fimH)
   02035 Bacterial motility proteins [BR:ecj02035]
    JW4283 (fimH)
Secretion system [BR:ecj02044]
 Chaperone-usher system
  Type 1 pilus assembly protein
   JW4283 (fimH)
Bacterial motility proteins [BR:ecj02035]
 Pilus system
  Fimbrial proteins
   JW4283 (fimH)
SSDB
Motif
Pfam: FimH_man-bind Fimbrial
Other DBs
NCBI-ProteinID: BAE78313
UniProt: P08191
Structure
Position
4553488..4554390
AA seq 300 aa
MKRVITLFAVLLMGWSVNAWSFACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLS
TQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRT
DKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTG
GCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQ
GVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
NT seq 903 nt   +upstreamnt  +downstreamnt
atgaaacgagttattaccctgtttgctgtactgctgatgggctggtcggtaaatgcctgg
tcattcgcctgtaaaaccgccaatggtaccgctatccctattggcggtggcagcgccaat
gtttatgtaaaccttgcgcccgtcgtgaatgtggggcaaaacctggtcgtggatctttcg
acgcaaatcttttgccataacgattatccggaaaccattacagactatgtcacactgcaa
cgaggctcggcttatggcggcgtgttatctaatttttccgggaccgtaaaatatagtggc
agtagctatccatttcctaccaccagcgaaacgccgcgcgttgtttataattcgagaacg
gataagccgtggccggtggcgctttatttgacgcctgtgagcagtgcgggcggggtggcg
attaaagctggctcattaattgccgtgcttattttgcgacagaccaacaactataacagc
gatgatttccagtttgtgtggaatatttacgccaataatgatgtggtggtgcctactggc
ggctgcgatgtttctgctcgtgatgtcaccgttactctgccggactaccctggttcagtg
ccaattcctcttaccgtttattgtgcgaaaagccaaaacctggggtattacctctccggc
acaaccgcagatgcgggcaactcgattttcaccaataccgcgtcgttttcacctgcacag
ggcgtcggcgtacagttgacgcgcaacggtacgattattccagcgaataacacggtatcg
ttaggagcagtagggacttcggcggtgagtctgggattaacggcaaattatgcacgtacc
ggagggcaggtgactgcagggaatgtgcaatcgattattggcgtgacttttgtttatcaa
taa

DBGET integrated database retrieval system