KEGG   Escherichia coli K-12 W3110: JW4288
Entry
JW4288            CDS       T00068                                 

Gene name
yjiC
Definition
(GenBank) hypothetical protein
Organism
ecj  Escherichia coli K-12 W3110
SSDB
Motif
Pfam: DUF2686
Other DBs
NCBI-ProteinID: BAE78318
UniProt: P39374
Position
complement(4560170..4561000)
AA seq 276 aa
MSMPLSNALQSQIITDAHFLHHPIVDSEFTRKLKYARMDSENIYLPPLTRGNNHNYDGKS
VVEIRKLDISKEPWPFNYVTGACRESDGITTTGRMLYRNLKITSALDEIYGGICKKAHAT
TELAEGLRLNLFMKSPFDPVEDYTVHEITLGPGCNVPGYAGTTIGYISTLPASQAKRWTN
EQPRIDIYIDQIMTVTGVANSSGFALAALLNANIELGNDPIIGIEAYPGTAEIHAKMGYK
VIPGDENAPLKRMTLQPSSLPELFELKNGEWNYIGK
NT seq 831 nt   +upstreamnt  +downstreamnt
atgtctatgccattaagcaatgcccttcagagtcaaattattacagatgctcacttcctt
catcacccaatagtcgacagtgagtttacacgtaaattaaaatatgcacgcatggattcg
gaaaacatctatcttccgcctcttactcgtggcaataaccataattacgatggaaaaagc
gttgtcgaaattagaaaacttgatattagtaaagagccttggccatttaattatgtgaca
ggagcatgcagagaatccgatggtattacaacaacaggacgtatgctctatcggaacttg
aaaatcacctcagctttagacgaaatatatggtggcatatgtaaaaaggcgcatgctacc
acagagttagcagaaggtttacggctaaatttatttatgaagagccctttcgatcctgtt
gaggactatacagttcatgaaataacattaggccctggttgcaatgttcctggttatgcc
ggaaccacgataggatatatttcaacccttccagcttctcaggcaaaaagatggaccaat
gagcagccaaggattgatatctatattgatcagataatgacggtaacaggggtagcaaat
tcttccggattcgcccttgccgcattacttaatgctaatattgagttgggtaatgaccca
ataattggtatagaagcctatcccggtaccgcggagatccatgcaaaaatgggatataaa
gttatcccgggtgatgaaaatgcaccactcaaacgtatgactctgcaaccgtcatctctt
ccagaactgtttgaattaaaaaatggtgaatggaattatattggtaaataa

DBGET integrated database retrieval system