KEGG   Escherichia coli K-12 W3110: JW4299Help
Entry
JW4299            CDS       T00068                                 

Gene name
yjiN
Definition
(GenBank) conserved inner membrane protein
Organism
ecj  Escherichia coli K-12 W3110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF445
Motif
Other DBs
NCBI-ProteinID: BAE78329
UniProt: P39385
Position
complement(4570646..4571926)
Genome map
AA seq 426 aa AA seqDB search
MNKLIELRRAKRLALSLLLIAAATFVVTLFLPPNFWVSGVKAIAEAAMVGALADWFAVVA
LFRRVPIPIISRHTAIIPRNKDRIGENLGQFVQEKFLDTQSLVALIRRHEPALLIGNWFS
QPENARRVGQHLLQIMSGFLELTDDARIQRLLKRAVHRAIDKVDLSGTSALMLESMTKND
RHQVLLDTLIAQLIALLQRDKSRKFIAQQIVRWLESEHPLKAKILPTEWLGEHSAELVSD
AVNSLLDDISRDRAHQIRHAFDRATFALIDKLKNDPEMAARADAVKSYLKEDEAFNRYLS
ELWGDLREWLKVDINSEDSRVKERIARAGQWFGETLIADDALRASLNGHLEQAAHRVAPE
FSAFLTRHISDTVKSWDARDMSRQIELNIGKDLQFIRVNGTLVGGCIGLILYLLSQLPAL
FPLGNF
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaataaactcatcgaactcagacgcgccaaaaggttggcgctctctttactgcttatc
gccgctgctacctttgtcgttacgctgtttttgccgcccaatttttgggtgagcggcgtg
aaggcgattgctgaagcggcgatggtcggcgcgctggcggactggtttgcggtggtggcg
ctgtttcgccgcgtgccgattccgatcatttctcgccatacggcgattatcccgcgtaat
aaagaccggattggcgaaaatctcggccagttcgtgcaggaaaaatttcttgatactcaa
tccctggtggcattgattcgacgccacgaaccggcgttgctgattggcaactggtttagc
cagccagaaaacgcccgccgcgttggtcagcatctgttgcagatcatgagcggttttctc
gaacttaccgatgatgcgcgtattcagcgcctgcttaagcgcgcggtccatcgggcgatt
gataaggtcgatctttccggcaccagtgcgttgatgctggagagtatgaccaaaaacgat
cgtcatcaggtgctgctggatacgctgatcgcacagttgatcgcccttctccagcgcgat
aaatcgcgcaagtttatcgcccagcaaattgttcgctggctggagagcgagcatccactg
aaagccaaaattctccccaccgaatggttgggcgaacatagcgcggagttggtttctgac
gcggtgaattctttgcttgatgatattagtcgcgatcgtgcgcatcagatccgccatgcg
tttgatcgcgccaccttcgccctgatcgacaagctgaaaaacgatccggaaatggcagcg
cgagccgatgccgtaaaaagctatctgaaagaagatgaagcttttaatcgctatctcagt
gaattgtggggggatttacgggaatggctgaaagtggatatcaacagtgaagattctcgt
gtgaaagaacgcatcgcacgagcgggtcaatggtttggcgaaacgttaattgccgatgat
gccttgcgggcgtcgttaaatggtcatcttgaacaagccgcgcaccgcgtcgcgcctgag
ttttccgcattcctgacgcgccacatcagcgatacggtaaaaagctgggatgcgcgggat
atgtcgcggcaaatagagttaaatatcggcaaagatctgcagtttattcgtgtcaacggt
acgctggttggcggttgtattgggctaattttatatttgctgtcgcagctcccggccttg
ttccccctcggcaatttttag

DBGET integrated database retrieval system