KEGG   Escherichia coli K-12 W3110: JW4300Help
Entry
JW4300            CDS       T00068                                 

Gene name
yjiO
Definition
(GenBank) multidrug efflux system protein
  KO
K23241  MFS transporter, DHA1 family, multidrug resistance protein
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW4300 (yjiO)
Transporters [BR:ecj02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    JW4300 (yjiO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr
Motif
Other DBs
NCBI-ProteinID: BAE78330
UniProt: P39386
Position
complement(4571967..4573199)
Genome map
AA seq 410 aa AA seqDB search
MPRFFTRHAATLFFPMALILYDFAAYLSTDLIQPGIINVVRDFNADVSLAPAAVSLYLAG
GMALQWLLGPLSDRIGRRPVLITGALIFTLACAATMFTTSMTQFLIARAIQGTSICFIAT
VGYVTVQEAFGQTKGIKLMAIITSIVLIAPIIGPLSGAALMHFMHWKVLFAIIAVMGFIS
FVGLLLAMPETVKRGAVPFSAKSVLRDFRNVFCNRLFLFGAATISLSYIPMMSWVAVSPV
ILIDAGSLTTSQFAWTQVPVFGAVIVANAIVARFVKDPTEPRFIWRAVPIQLVGLSLLIV
GNLLSPHVWLWSVLGTSLYAFGIGLIFPTLFRFTLFSNKLPKGTVSASLNMVILMVMSVS
VEIGRWLWFNGGRLPFHLLAVVAGVIVVFTLAGLLNRVRQHQAAELVEEQ
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgccacgtttttttacccgccatgccgccacgctgtttttcccgatggcgttgattttg
tatgactttgctgcgtatctgtcgacggatctgatccagcctgggatcattaatgtggta
cgtgattttaatgccgatgtcagtctggcccctgctgccgtcagtctctatcttgctggc
ggtatggcgttacagtggctgctggggccgctttccgacagaattggccgcaggccggtg
ctgattaccggggcgctaatttttacccttgcctgcgccgcgacaatgttcacaacgtct
atgacacagtttcttatcgcgcgtgcaattcagggcaccagtatctgttttattgccacc
gttggttatgtcacggtgcaggaggcgttcggacagacaaaagggatcaagttgatggcg
attatcacctccatcgtactgattgcgccgattatcggcccgctttccggcgcagctctg
atgcactttatgcactggaaagtcctttttgccatcattgcggttatgggttttatctca
tttgttggcttactgttggcgatgccagagacggtgaagcgcggcgcggttccgtttagc
gccaaaagcgtcttgcgcgattttcgtaatgtcttttgcaatcggctgttcctctttggc
gcagcaaccatctctttaagctatatcccgatgatgagctgggtggctgtctcgccggtg
atccttatcgatgcaggcagcttaacaacttcgcagttcgcctggacacaggttccggtg
ttcggcgcggtgattgttgcgaatgccatcgtggcgcgttttgttaaagatccgaccgaa
ccgcggtttatctggcgtgccgtacccattcaactggtcggcctctcgctgttgattgtc
ggcaatctgctgtcgccgcacgtctggctgtggtcggtgctgggcaccagtctgtatgct
ttcgggattggtttgattttcccgaccttattccgctttacgctgttttccaataagtta
ccgaaagggaccgtctccgcatcgctaaatatggtgatcctgatggtgatgtcggtctcg
gtcgaaatcggccgctggctatggtttaacggcggtcgcttgccgtttcatctgttagcc
gttgtggcgggcgttatcgtcgttttcaccctggcgggattgctcaatcgcgtgcgccag
catcaggcagccgagctagtggaggagcagtga

DBGET integrated database retrieval system