KEGG   Escherichia coli K-12 W3110: JW4356Help
Entry
JW4356            CDS       T00068                                 

Gene name
trpR
Definition
(GenBank) DNA-binding transcriptional repressor, tryptophan-binding
  KO
K03720  TrpR family transcriptional regulator, trp operon repressor
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecj03000]
    JW4356 (trpR)
Transcription factors [BR:ecj03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    JW4356 (trpR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_repressor HTH_5
Motif
Other DBs
NCBI-ProteinID: BAE78382
UniProt: P0A881
Structure
PDB: 

Position
4637440..4637766
Genome map
AA seq 108 aa AA seqDB search
MAQQSPYSAAMAEQRHQEWLRFVDLLKNAYQNDLHLPLLNLMLTPDEREALGTRVRIVEE
LLRGEMSQRELKNELGAGIATITRGSNSLKAAPVELRQWLEEVLLKSD
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggcccaacaatcaccctattcagcagcgatggcagaacagcgtcaccaggagtggtta
cgttttgtcgacctgcttaagaatgcctaccaaaacgatctccatttaccgttgttaaac
ctgatgctgacgccagatgagcgcgaagcgttggggactcgcgtgcgtattgtcgaagag
ctgttgcgcggcgaaatgagccagcgtgagttaaaaaatgaactcggcgcaggcatcgcg
acgattacgcgtggatctaacagcctgaaagccgcgcccgtcgagctgcgccagtggctg
gaagaggtgttgctgaaaagcgattga

DBGET integrated database retrieval system