KEGG   Escherichia coli K-12 W3110: JW5046Help
Entry
JW5046            CDS       T00068                                 

Gene name
mhpT
Definition
(GenBank) predicted 3-hydroxyphenylpropionic transporter
  KO
K05819  MFS transporter, AAHS family, 3-hydroxyphenylpropionic acid transporter
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW5046 (mhpT)
Transporters [BR:ecj02000]
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Aromatic acid:H+ symporter (AAHS) family [TC:2.A.1.15]
    JW5046 (mhpT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_4 MFS_Mycoplasma
Motif
Other DBs
NCBI-ProteinID: BAE76135
UniProt: P77589
Position
374683..375894
Genome map
AA seq 403 aa AA seqDB search
MSTRTPSSSSSRLMLTIGLCFLVALMEGLDLQAAGIAAGGIAQAFALDKMQMGWIFSAGI
LGLLPGALVGGMLADRYGRKRILIGSVALFGLFSLATAIAWDFPSLVFARLMTGVGLGAA
LPNLIALTSEAAGPRFRGTAVSLMYCGVPIGAALAATLGFAGANLAWQTVFWVGGVVPLI
LVPLLMRWLPESAVFAGEKQSAPPLRALFAPETATATLLLWLCYFFTLLVVYMLINWLPL
LLVEQGFQPSQAAGVMFALQMGAASGTLMLGALMDKLRPVTMSLLIYSGMLASLLALGTV
SSFNGMLLAGFVAGLFATGGQSVLYALAPLFYSSQIRATGVGTAVAVGRLGAMSGPLLAG
KMLALGTGTVGVMAASAPGILVAGLAVFILMSRRSRIQPCADA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactcgtaccccttcatcatcttcatcccgcctgatgctgaccatcgggctttgt
tttttggtcgctctgatggaagggctggatcttcaggcggctggcattgcggcgggtggc
atcgcccaggctttcgcactcgataaaatgcaaatgggctggatatttagcgccggaata
ctcggtttgctacccggcgcgttggttggcggaatgctggcggaccgttatggtcgcaag
cgcattttgattggctcagttgcgctgtttggtttgttctcactggcaacggcgattgcc
tgggatttcccctcactggtctttgcgcggctgatgaccggtgtcgggctgggggcggcg
ttgccgaatcttatcgccctgacgtctgaagccgcgggtccacgttttcgtgggacggca
gtgagcctgatgtattgcggtgttcccattggcgcggcgctggcggcgacactgggtttc
gcgggggcaaacttagcatggcaaacggtgttttgggtaggtggtgtggtgccgttgatt
ctggtgccgctattaatgcgctggctgccggagtcggcggttttcgctggcgaaaaacag
tctgcgccaccactgcgtgccttatttgcgccagaaacggcaaccgcgacgctgctgctg
tggttgtgttatttcttcactctgctggtggtctacatgttgatcaactggctaccgcta
cttttggtggagcaaggattccagccatcgcaggcggcaggggtgatgtttgccctgcaa
atgggggcggcaagcgggacgttaatgttgggcgcattgatggataagctgcgtccagta
accatgtcgctactgatttatagcggcatgttagcttcgctgctggcgcttggaacggtg
tcgtcatttaacggtatgttgctggcgggatttgtcgcggggttgtttgcgacaggtggg
caaagcgttttgtatgccctggcaccgttgttttacagttcgcagatccgcgcaacaggt
gtgggaacagccgtggcggtagggcgtctgggggctatgagcggtccgttactggccggg
aaaatgctggcattaggcactggcacggtcggcgtaatggccgcttctgcaccgggtatt
cttgttgctgggttggcggtgtttattttgatgagccggagatcacgaatacagccgtgc
gccgatgcctga

DBGET integrated database retrieval system