KEGG   Escherichia coli K-12 W3110: JW5108
Entry
JW5108            CDS       T00068                                 

Symbol
ybiO
Name
(GenBank) predicted mechanosensitive channel
  KO
K22044  moderate conductance mechanosensitive channel
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW5108 (ybiO)
Transporters [BR:ecj02000]
 Other transporters
  Pores ion channels [TC:1]
   JW5108 (ybiO)
SSDB
Motif
Pfam: MS_channel
Other DBs
NCBI-ProteinID: BAA35474
UniProt: P75783
Position
complement(843677..845902)
AA seq 741 aa
MRWILFILFCLLGAPAHAVSIPGVTTTTTTDSTTEPAPEPDIEQKKAAYGALADVLDNDT
SRKELIDQLRTVAATPPAEPVPKIVPPTLVEEQTVLQKVTEVSRHYGEALSARFGQLYRN
ITGSPHKPFNPQTFSNALTHFSMLAVLVFGFYWLIRLCALPLYRKMGQWARQKNRERSNW
LQLPAMIIGAFIIDLLLLALTLFVGQVLSDNLNAGSRTIAFQQSLFLNAFALIEFFKAVL
RLIFCPNVAELRPFTIQDESARYWSRRLSWLSSLIGYGLIVAVPIISNQVNVQIGALANV
IIMLCMTVWALYLIFRNKKEITQHLLNFAEHSLAFFSLFIRAFALVWHWLASAYFIVLFF
FSLFDPGNSLKFMMGATVRSLAIIGIAAFVSGMFSRWLAKTITLSPHTQRNYPELQKRLN
GWLSAALKTARILTVCVAVMLLLSAWGLFDFWNWLQNGAGQKTVDILIRIALILFFSAVG
WTVLASLIENRLASDIHGRPLPSARTRTLLTLFRNALAVIISTITIMIVLSEIGVNIAPL
LAGAGALGLAISFGSQTLVKDIITGVFIQFENGMNTGDLVTIGPLTGTVERMSIRSVGVR
QDTGAYHIIPWSSITTFANFVRGIGSVVANYDVDRHEDADKANQALKDAVAELMENEEIR
GLIIGEPNFAGIVGLSNTAFTLRVSFTTLPLKQWTVRFALDSQVKKHFDLAGVRAPVQTY
QVLPAPGATPAEPLPPGEPTL
NT seq 2226 nt   +upstreamnt  +downstreamnt
atgcggtggatcctgttcatcctcttctgcctgctgggcgcacctgcccacgcggtatcc
atacccggcgttacaaccacaacgacaacggactcaacgactgaaccggccccggaaccg
gatatcgaacaaaaaaaagcggcctatggcgcactggcggatgtgctggataatgacacc
tcgcgtaaagagttgatcgaccagttgcgcaccgttgccgctacgccccctgctgaaccg
gtaccaaaaatagtgccgccgacgctggtcgaagagcaaaccgtgctgcaaaaggtcacc
gaagtcagccgccattatggtgaagccctttccgcccgcttcgggcaactttatcgcaat
atcaccggctccccgcataagccgtttaatccacaaaccttcagcaatgcgctgacccat
ttttcaatgttagcggtattagtgtttggtttttactggctgattcgcctgtgcgcactg
ccgctgtatcgcaaaatgggtcagtgggcgcggcaaaaaaatcgtgagcgcagcaactgg
ttgcagcttccggcgatgattatcggggcgtttattatcgacctgctgttactggccctg
acattatttgtcggccaggtattaagcgacaacctgaatgcaggcagtcgcaccatcgct
ttccaacaaagtttgtttctcaacgcctttgccctcattgaatttttcaaagccgtacta
cgcctgattttttgcccaaacgtggcggagctgcgcccgttcacgattcaggacgagagc
gcccgttactggagtcgtcgcctgagctggttaagcagtttgataggttatggcctgatt
gtggccgtgccgattatctctaatcaggtgaatgtacagataggtgcgctggcgaacgtc
atcattatgctgtgcatgaccgtctgggcgttgtacctgatctttcgtaataaaaaagag
attacccagcatttgctcaacttcgcggagcattcgctggcctttttcagcctgtttatc
cgcgcctttgcgctggtgtggcactggctggcaagcgcctattttatcgtgctgtttttc
ttttcgttgttcgatccgggcaacagcctgaaatttatgatgggtgcaacggtgcgcagc
ctggcgattattggtatcgcagcgtttgtttccggtatgttttcccgctggctggcgaaa
accatcactctctcgccacatactcagcgtaactatccggagctgcaaaaacggttgaat
ggctggctgtcggcggcgctgaaaacggcgcgtattctgacagtctgcgtggcggtaatg
ttgctgttgagcgcatggggattgttcgatttctggaactggctgcaaaacggcgcgggg
cagaaaaccgtagatatcctgatccgtatcgcactcattcttttcttctcggcggttggc
tggacggtgctcgccagtttgatcgaaaaccggctggcttcggatattcatggccgcccg
ctacccagcgcccgcacgcgtaccctgcttacgctgtttcgtaacgcgctggcggtgatt
atcagtaccatcaccatcatgattgtgttgtcggaaatcggcgtcaatatcgcgccattg
ctggcaggtgccggggcattaggtctggctatctcgtttggttcgcaaacgctggtgaaa
gatattatcaccggggtatttattcagtttgaaaacggcatgaacactggagatttggtg
actatcgggccgttgaccggcacagtggaacggatgtcgattcgctccgtgggcgtacga
caggataccggggcgtatcacatcattccgtggtcttcgataaccacctttgctaacttt
gtccgcggcattggttcggtggtggcaaattatgatgttgatcgccatgaagatgctgat
aaagccaatcaggcactgaaagatgcggtagcggaattaatggaaaacgaagaaattcgc
gggctgattattggtgaaccgaattttgccgggattgtcggcttaagcaataccgcgttt
acactgcgtgtttcgttcaccacgctgccactcaaacagtggacggtacgctttgccctc
gacagccaggtgaaaaaacatttcgacctggcgggcgttcgcgcgccagtgcagacttat
caggtgctgcctgctccgggcgcgaccccggctgaaccgttaccgccgggggaaccaacg
ctttaa

DBGET integrated database retrieval system