KEGG   Escherichia coli K-12 W3110: JW5142Help
Entry
JW5142            CDS       T00068                                 

Gene name
ycdR
Definition
(GenBank) predicted enzyme associated with biofilm formation
  KO
K11931  poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase [EC:3.5.1.-]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02026  Biofilm formation - Escherichia coli
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02026 Biofilm formation - Escherichia coli
    JW5142 (ycdR)
Enzymes [BR:ecj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.-  
     JW5142 (ycdR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHL13 Polysacc_deac_1 GHL10
Motif
Other DBs
NCBI-ProteinID: BAA35805
UniProt: P75906
Structure
PDB: 

Position
complement(1088261..1090279)
Genome map
AA seq 672 aa AA seqDB search
MLRNGNKYLLMLVSIIMLTACISQSRTSFIPPQDRESLLAEQPWPHNGFVAISWHNVEDE
AADQRFMSVRTSALREQFAWLRENGYQPVSIAQIREAHRGGKPLPEKAVVLTFDDGYQSF
YTRVFPILQAFQWPAVWAPVGSWVDTPADKQVKFGDELVDREYFATWQQVREVARSRLVE
LASHTWNSHYGIQANATGSLLPVYVNRAYFTDHARYETAAEYRERIRLDAVKMTEYLRTK
VEVNPHVFVWPYGEANGIAIEELKKLGYDMFFTLESGLANASQLDSIPRVLIANNPSLKE
FAQQIITVQEKSPQRIMHIDLDYVYDENLQQMDRNIDVLIQRVKDMQISTVYLQAFADPD
GDGLVKEVWFPNRLLPMKADIFSRVAWQLRTRSGVNIYAWMPVLSWDLDPTLTRVKYLPT
GEKKAQIHPEQYHRLSPFDDRVRAQVGMLYEDLAGHAAFDGILFHDDALLSDYEDASAPA
ITAYQQAGFSGSLSEIRQNPEQFKQWARFKSRALTDFTLELSARVKAIRGPHIKTARNIF
ALPVIQPESEAWFAQNYADFLKSYDWTAIMAMPYLEGVAEKSADQWLIQLTNQIKNIPQA
KDKSILELQAQNWQKNGQHQAISSQQLAHWMSLLQLNGVKNYGYYPDNFLHNQPEIDLIR
PEFSTAWYPKND
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgttacgtaatggaaataaatatctcctgatgctggtgagtataattatgctcaccgcg
tgcattagccagtcaagaacatcatttataccgccacaggatcgcgaatctttactcgcc
gagcaaccgtggccgcataatggttttgtagcgatttcatggcataacgttgaagacgaa
gctgccgaccagcgttttatgtcagtgcggacatcagcactgcgtgaacaatttgcctgg
ctgcgcgagaacggttatcaaccggtcagtattgctcaaattcgtgaagcacatcgagga
ggaaaaccgctaccggaaaaagctgtagtgctgacttttgatgacggctaccagagtttt
tatacccgcgtcttcccaattcttcaggccttccagtggcctgctgtatgggcccccgtc
ggcagttgggtcgatacgccagcggataaacaagtaaaatttggcgatgagttggtcgat
cgagaatattttgccacgtggcaacaagtgcgagaagttgcgcgttcccggctcgttgag
ctcgcttctcatacatggaattctcactacggtattcaggctaatgccaccggcagctta
ttgcctgtatatgtaaatcgtgcatattttactgaccacgcacggtatgaaaccgcagca
gaataccgggaaagaattcgtctggatgctgtaaaaatgacggaatacctgcgtacaaag
gttgaggtaaatccacacgtttttgtttggccttatggcgaagcgaatggcatagcgata
gaggaattaaaaaaactcggttatgacatgttcttcacccttgaatcaggtttggcaaat
gcgtcgcaattggattccattccgcgggtattaatcgccaataatccctcattaaaagag
tttgcccagcaaattattaccgtacaggaaaaatcaccacaacggataatgcatatcgat
cttgattacgtttatgacgaaaacctccagcaaatggatcgcaatattgatgtgctaatt
cagcgggtgaaagatatgcaaatatcaaccgtgtatttgcaggcatttgctgatcccgat
ggtgatgggctggtcaaagaggtctggtttccaaatcgtttgctaccaatgaaagcagat
atttttagtcgggttgcctggcaattacgtacccgctcaggtgtaaacatctatgcgtgg
atgccggtattaagctgggatttagatcccacattaacgcgagtaaaatacttaccaaca
ggggagaaaaaagcacaaattcatcctgaacaatatcaccgtctctctcctttcgatgac
agagtcagagcacaagttggcatgttatatgaagatcttgccggacatgctgcttttgat
ggcatattgttccacgatgatgctttgctttcagattatgaagatgccagtgcaccggct
atcacggcttatcagcaagcaggctttagcgggagtctgagcgaaattcgacaaaacccg
gagcaatttaaacagtgggcccgctttaaaagtcgtgcgttaactgacttcactttagaa
cttagtgcgcgcgtaaaagccattcgcggtccacatattaaaactgcacgaaatattttt
gcacttccggtaatacaacctgaaagtgaagcctggtttgcacagaattatgctgatttc
ctaaaaagctatgactggaccgctattatggctatgccttatctggaaggtgtcgcagaa
aaatcggctgaccaatggttaatacaattgaccaatcaaattaaaaacatccctcaggct
aaagacaaatctattttagaattacaggcacaaaactggcagaaaaatggtcagcatcag
gctatttcttcgcaacaactcgctcactggatgagcctattacaactgaatggagtgaaa
aactatggttattatcccgacaattttctgcataaccaacctgaaatagaccttattcgt
cctgagttttcaacagcctggtatccgaaaaatgattaa

DBGET integrated database retrieval system