KEGG   Escherichia coli K-12 W3110: JW5150
Entry
JW5150            CDS       T00068                                 

Gene name
ymdC
Definition
(GenBank) predicted hydrolase
  KO
K06132  cardiolipin synthase C [EC:2.7.8.-]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00564  Glycerophospholipid metabolism
ecj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    JW5150 (ymdC)
Enzymes [BR:ecj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.-  
     JW5150 (ymdC)
SSDB
Motif
Pfam: PLDc_2 PLDc
Other DBs
NCBI-ProteinID: BAA35836
UniProt: P75919
Position
1107932..1109353
AA seq 473 aa
MPRLASAVLPLCSQHPGQCGLFPLEKSLDAFAARYRLAEMAEHTLDVQYYIWQDDMSGRL
LFSALLAAAKRGVRVRLLLDDNNTPGLDDILRLLDSHPRIEVRLFNPFSFRLLRPLGYIT
DFSRLNRRMHNKSFTVDGVVTLVGGRNIGDAYFGAGEEPLFSDLDVMAIGPVVEDVADDF
ARYWYCKSVSPLQQVLDVPEGEMADRIELPASWHNDAMTHRYLRKMESSPFINHLVDGTL
PLIWAKTRLLSDDPAKGEGKAKRHSLLPQRLFDIMGSPSERIDIISSYFVPTRAGVAQLL
RMVRKGVKIAILTNSLAANDVAVVHAGYARWRKKLLRYGVELYELKPTREQSSTLHDRGI
TGNSGASLHAKTFSIDGKTVFIGSFNFDPRSTLLNTEMGFVIESETLAQLIDKRFIQSQY
DAAWQLRLDRWGRINWVDRHAKKEIILKKEPATSFWKRVMVRLASILPVEWLL
NT seq 1422 nt   +upstreamnt  +downstreamnt
ttgccccggctggcgagcgcggtgctgccactgtgttcgcaacatcccggtcagtgtggc
ctttttcctctggagaaaagtctggatgcgtttgccgcccggtatcgtctggccgaaatg
gcagagcatacgctcgatgttcagtattacatctggcaggacgatatgtcgggtcggtta
ctgttttccgccctgttagccgcagcaaagcgtggcgttcgcgtccgtttgttgctggac
gacaacaatacgcccggacttgacgacattttacgcttgcttgacagtcatccacgcatt
gaagtccggctttttaatcctttctcgtttcgcttgctgcgtccgcttggttatatcacc
gacttttcccgtcttaatcgccgtatgcacaataaaagtttcactgtcgatggcgtggtg
accctggtgggaggacgaaatattggtgatgcctattttggagcaggggaggagccactt
ttttcggatttagatgtcatggcaataggacccgtggtagaggacgttgccgatgatttc
gcccgctactggtattgcaaatcggtttcacccttacagcaggtgctggatgtcccggag
ggtgaaatggcggatcgcatcgagttacccgcctcctggcataacgatgccatgacgcat
cgttatttacgcaaaatggaatccagtccatttataaatcatctggttgatggaacattg
ccgcttatctgggcgaagacacgtttattaagtgatgatccggcgaaaggggagggcaag
gcaaaacggcattcactgttaccgcagcgcctgttcgatatcatgggctcacccagtgaa
cgcatcgatattatctcttcctattttgtaccgacacgcgcaggtgtggcgcaactctta
cggatggtgagaaaaggggtaaagattgcgatcctaaccaattctcttgccgctaacgat
gttgctgtcgtccatgccggatacgcgcgctggcgcaaaaaattgctccgctatggcgtg
gaattatatgaactcaagccgacgcgtgaacaaagtagtacgttacacgatcgcggcata
accggtaattccggagccagcctgcatgctaaaacctttagcatcgatggtaaaacggtg
tttatcggctctttcaatttcgatccgcgttcaacattgctcaatactgaaatgggcttc
gtgatagagagcgaaacgctggcacagttaattgataaacgctttattcagagccagtat
gatgcggcctggcagctccgtctggacaggtggggacggatcaactgggttgatcgtcat
gcaaagaaagagattattctcaaaaaagaacccgccaccagtttctggaagcgggttatg
gtcagactggcgtcgatattgcccgtggaatggttattgtaa

DBGET integrated database retrieval system