KEGG   Escherichia coli K-12 W3110: JW5196Help
Entry
JW5196            CDS       T00068                                 

Gene name
yciO
Definition
(GenBank) conserved hypothetical protein
Organism
ecj  Escherichia coli K-12 W3110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sua5_yciO_yrdC FlbD Methyltr_RsmB-F
Motif
Other DBs
NCBI-ProteinID: BAA14801
UniProt: P0AFR4
Structure
PDB: 

Position
1325812..1326432
Genome map
AA seq 206 aa AA seqDB search
MSQFFYIHPDNPQQRLINQAVEIVRKGGVIVYPTDSGYALGCKIEDKNAMERICRIRQLP
DGHNFTLMCRDLSELSTYSFVDNVAFRLMKNNTPGNYTFILKGTKEVPRRLLQEKRKTIG
MRVPSNPIAQALLEALGEPMLSTSLMLPGSEFTESDPEEIKDRLEKQVDLIIHGGYLGQK
PTTVIDLTDDTPVVVREGVGDVKPFL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagccagtttttttatattcatcctgataacccacagcaacgtctgatcaaccaggcg
gtggagatcgtgcgtaaaggcggggtgattgtttatccaactgattccggctatgcgctc
ggctgtaaaattgaagataaaaacgcgatggagcgtatttgtcgtattcgccagctgccg
gacggtcacaactttaccctgatgtgtcgcgatctttctgaactctcgacctattcattt
gttgataacgttgcgtttcgtttaatgaaaaacaacacgccgggcaactataccttcatc
ctgaaggggacgaaggaagtgccacgccgtctgttgcaggaaaaacgcaaaaccatcggt
atgcgtgtgccttctaaccctatcgctcaggcgttacttgaagcattgggcgaaccgatg
ctttccacttcgctaatgctgccaggcagcgaatttaccgaatcggacccggaagaaatt
aaagatcgtctggaaaaacaggtagatttgattattcacggcggctatctcgggcagaaa
ccgacaacggttattgatcttaccgatgatacgccggtcgtggtgcgtgaaggcgtaggt
gatgtgaagcctttcttataa

DBGET integrated database retrieval system