KEGG   Escherichia coli K-12 W3110: JW5240Help
Entry
JW5240            CDS       T00068                                 

Gene name
ddpA
Definition
(GenBank) D-Ala-D-Ala transporter subunit
  KO
K02035  peptide/nickel transport system substrate-binding protein
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02024  Quorum sensing
Module
ecj_M00239  Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    JW5240 (ddpA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW5240 (ddpA)
Transporters [BR:ecj02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    JW5240 (ddpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_5
Motif
Other DBs
NCBI-ProteinID: BAA15142
UniProt: P76128
Position
complement(1562645..1564195)
Genome map
AA seq 516 aa AA seqDB search
MKRSISFRPTLLALVLATNFPVAHAAVPKDMLVIGKAADPQTLDPAVTIDNNDWTVTYPS
YQRLVQYKTDGDKGSTDVEGDLASSWKASDDQKEWTFTLKDNAKFADGTPVTAEAVKLSF
ERLLKIGQGPAEAFPKDLKIDAPDEHTVKFTLSQPFAPFLYTLANDGASIINPAVLKEHA
ADDARGFLAQNTAGSGPFMLKSWQKGQQLVLVPNPHYPGNKPNFKRVSVKIIGESASRRL
QLSRGDIDIADALPVDQLNALKQENKVNVAEYPSLRVTYLYLNNSKAPLNQADLRRAISW
STDYQGMVNGILSGNGKQMRGPIPEGMWGYDATAMQYNHDETKAKAEWDKVTSKPTSLTF
LYSDNDPNWEPIALATQSSLNKLGIIVKLEKLANATMRDRVGKGDYDIAIGNWSPDFADP
YMFMNYWFESDKKGLPGNRSFYENSEVDKLLRNALATTDQTQRTRDYQQAQKIVIDDAAY
VYLFQKNYQLAMNKEVKGFVFNPMLEQVFNINTMSK
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgaagagatcgatatcgtttcgtcccacattgctcgcgctcgtccttgccacaaatttc
ccggttgcgcacgccgccgtaccaaaagatatgctggtgattggtaaggccgccgatcca
caaaccctcgacccggcggtaacaatagataataacgactggacagtgacctacccgtct
tatcagcggctggttcagtacaaaacggacggtgataaaggctcaaccgacgttgaaggc
gatctggcaagtagctggaaagcgtctgacgatcaaaaagagtggacgttcaccctgaaa
gataatgctaaatttgccgatggcacacctgtcactgccgaagcagtaaaactttctttt
gagcggctactaaaaatcggccaggggccagcagaagcatttcccaaagatttaaagatt
gatgctcccgacgaacatacggtgaagtttacccttagccaaccattcgcaccgttcctc
tacacgctggcgaatgacggtgcatccattatcaatccggcggtcttaaaggaacatgca
gcggatgatgctcgcggcttcctcgcgcaaaataccgccggttccggaccatttatgctg
aaaagctggcaaaaaggtcagcaattagttctggtgccaaatccgcattacccaggcaat
aaaccgaacttcaaacgggtatcggtaaaaattattggtgaaagtgcctcccgtcgcctg
cagctctcccgtggcgacattgacattgccgatgcgctgccggtggatcaactcaacgcc
ctgaagcaggaaaataaagtcaatgtggcagagtatccgtcactgcgcgttacctatctg
tatctgaataacagcaaagcgcctcttaatcaggcggatctgcgtcgggccatttcctgg
tctaccgattatcagggcatggttaacggcattctgagtggtaacggaaaacagatgcgc
ggcccgattccggaaggcatgtggggctacgatgcgacggcaatgcaatacaaccatgac
gaaacgaaagccaaagccgaatgggataaagtgacgagcaaacccaccagcctgacgttt
ctctactccgataacgatccgaactgggagcctattgctctggcgacacaatccagtctc
aacaagctgggcatcattgtgaagctggaaaagctggcgaacgccaccatgcgcgacaga
gtgggtaaaggtgattacgacattgcgattggcaactggagtccggattttgccgacccg
tatatgtttatgaattactggtttgagtcagacaaaaaaggtctgccgggtaaccgctcg
ttctatgaaaacagtgaggtcgataagttactgcgcaatgcgcttgcgaccaccgaccag
acgcagcgtacccgggactaccagcaggcacagaaaatcgtcattgatgacgctgcttat
gtgtacctgttccagaaaaactaccaactggcgatgaacaaagaggtgaaaggctttgtg
ttcaatcccatgctggaacaggtcttcaatatcaataccatgagtaaataa

DBGET integrated database retrieval system