KEGG   Escherichia coli K-12 W3110: JW5250
Entry
JW5250            CDS       T00068                                 
Symbol
eamA
Name
(GenBank) cysteine and O-acetyl-L-serine efflux system
  KO
K15268  O-acetylserine/cysteine efflux transporter
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW5250 (eamA)
Transporters [BR:ecj02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   JW5250 (eamA)
SSDB
Motif
Pfam: EamA CRT-like TPT
Other DBs
NCBI-ProteinID: BAA15223
UniProt: P31125
Position
complement(1621952..1622851)
AA seq 299 aa
MSRKDGVLALLVVVVWGLNFVVIKVGLHNMPPLMLAGLRFMLVAFPAIFFVARPKVPLNL
LLGYGLTISFAQFAFLFCAINFGMPAGLASLVLQAQAFFTIMLGAFTFGERLHGKQLAGI
ALAIFGVLVLIEDSLNGQHVAMLGFMLTLAAAFSWACGNIFNKKIMSHSTRPAVMSLVIW
SALIPIIPFFVASLILDGSATMIHSLVTIDMTTILSLMYLAFVATIVGYGIWGTLLGRYE
TWRVAPLSLLVPVVGLASAALLLDERLTGLQFLGAVLIMTGLYINVFGLRWRKAVKVGS
NT seq 900 nt   +upstreamnt  +downstreamnt
atgtcgcgaaaagatggggtgttggcgctactggtagtggtcgtatgggggctaaatttt
gtggtcatcaaagtggggcttcataacatgccaccgctgatgctggccggtttgcgcttt
atgctggtcgcttttccggctatcttttttgtcgcacgaccgaaagtaccactgaatttg
ctgctggggtatggattaaccatcagttttgcgcagtttgcttttcttttttgtgccatt
aacttcggtatgcctgctggactggcttcgctggtgttacaggcacaggcgttttttact
atcatgcttggcgcgtttactttcggggagcgactgcatggcaaacaattggcggggatc
gccttagcgatttttggcgtactggtgttaatcgaagatagtctgaacggtcagcatgtg
gcgatgctcggctttatgttgaccctggcggcagcatttagttgggcgtgtggcaacatc
ttcaataaaaagatcatgtcgcactcaacgcgtccggcggtgatgtcgctggtaatctgg
agcgctttaatcccaatcattcccttctttgttgcctcgctgattctcgatggttccgca
accatgattcacagtctggttactatcgatatgaccaccatcttgtctctgatgtatctg
gcgtttgtggcgacaattgttggttatgggatctgggggacgttactgggacgctatgaa
acctggcgggttgcaccgttatcgttactggtgcccgtagtaggactggcaagtgcggca
ctattgttggatgaacgcttaacgggtctgcaatttttaggtgcggtgctcattatgacc
gggctgtatatcaatgtatttggcttgcggtggcgtaaagcggtaaaggtgggaagttaa

DBGET integrated database retrieval system