KEGG   Escherichia coli K-12 W3110: JW5255
Entry
JW5255            CDS       T00068                                 

Symbol
essQ
Name
(GenBank) predicted S lysis protein
Organism
ecj  Escherichia coli K-12 W3110
SSDB
Motif
Pfam: Phage_holin_2_1 Phage_holin_2_3 DUF5455 Phage_holin_2_4 DUF5862
Other DBs
NCBI-ProteinID: BAA15255
UniProt: P77237
Position
complement(1642084..1642299)
AA seq 71 aa
MKSMDKLTTGVAYGTSAGNAGFWALQLLDKVTPSQWAAIGVLGSLVFGLLTYLTNLYFKI
KEDRRKAARGE
NT seq 216 nt   +upstreamnt  +downstreamnt
atgaaatcaatggataagttaacaacaggtgttgcctatggcacatcggcgggtaatgct
ggtttctgggcattgcagttactcgataaagtaactccgtcacagtgggctgcaatcggt
gtgctgggtagcctggtttttggcctgctgacgtatctgacaaatctttatttcaagatt
aaagaagacaggcgtaaggctgcgagaggagagtaa

DBGET integrated database retrieval system