KEGG   Escherichia coli K-12 W3110: JW5275
Entry
JW5275            CDS       T00068                                 

Gene name
ydiO
Definition
(GenBank) predicted acyl-CoA dehydrogenase
Organism
ecj  Escherichia coli K-12 W3110
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_2 Acyl-CoA_dh_N YopD
Other DBs
NCBI-ProteinID: BAA15464
UniProt: P0A9U8
Position
1778910..1780061
AA seq 383 aa
MDFSLTEEQELLLASIRELITTNFPEEYFRTCDQNGTYPREFMRALADNGISMLGVPEEF
GGIPADYVTQMLALMEVSKCGAPAFLITNGQCIHSMRRFGSAEQLRKTAESTLETGDPAY
ALALTEPGAGSDNNSATTTYTRKNGKVYINGQKTFITGAKEYPYMLVLARDPQPKDPKKA
FTLWWVDSSKPGIKINPLHKIGWHMLSTCEVYLDNVEVEESDMVGEEGMGFLNVMYNFEM
ERLINAARSTGFAECAFEDAARYANQRIAFGKPIGHNQMIQEKLALMAIKIDNMRNMVLK
VAWQADQHQSLRTSAALAKLYCARTAMEVIDDAIQIMGGLGYTDEARVSRFWRDVRCERI
GGGTDEIMIYVAGRQILKDYQNK
NT seq 1152 nt   +upstreamnt  +downstreamnt
atggatttttctttaactgaagaacaagaactgctgctggccagtattcgcgaactgatt
acgactaactttccggaagagtatttccgcacctgcgatcaaaacgggacatatccgcgt
gagtttatgcgggcgctggcggataacggtatttccatgcttggcgtgccggaagaattt
ggtggtatccctgcggattacgtcacccaaatgctggcgctgatggaagtgtcaaaatgc
ggtgctccggcatttttaattaccaacggtcaatgtattcacagtatgcgccgtttcggt
tctgcagagcagctacgtaaaacggcagagagcaccctggaaacgggtgatcccgcctat
gccctggcgttgacggaaccaggtgctggctcagataacaacagtgccactaccacttac
acgcgtaaaaacggcaaggtctacatcaacggacaaaaaacctttattaccggtgcgaaa
gagtacccgtatatgctggtgctggcgcgcgatccgcaaccgaaagatcccaaaaaagcc
ttcaccctgtggtgggtcgactccagtaagcccggcattaagattaacccgctgcataaa
atcggctggcatatgctcagcacctgcgaagtctatctcgacaacgtggaggttgaagag
agcgacatggtgggcgaagaaggaatgggtttcctcaatgtgatgtacaactttgagatg
gagcgcctgatcaacgccgcgcgcagcaccggctttgccgaatgcgcctttgaagatgcc
gcccgctatgccaaccaacgtatcgcttttggtaagcccattggtcataaccagatgatc
caggaaaaactggcgctgatggcgattaagatcgacaacatgcgcaacatggtgctgaaa
gtggcatggcaagccgatcagcatcagtcactgcgcaccagcgcggcgctggcaaaactg
tactgtgcacgtaccgcaatggaagtcattgatgatgcgattcaaatcatgggcggtctg
ggctataccgatgaggcgcgcgtctcccgcttctggcgtgatgtccgttgtgaacgtatc
ggcggcggtacagacgaaattatgatttacgtagcaggtcggcagatcctgaaagactat
cagaacaaataa

DBGET integrated database retrieval system