KEGG   Escherichia coli K-12 W3110: JW5397Help
Entry
JW5397            CDS       T00068                                 

Gene name
hda
Definition
(GenBank) ATPase regulatory factor involved in DnaA inactivation
  KO
K10763  DnaA-homolog protein
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ecj03032]
    JW5397 (hda)
DNA replication proteins [BR:ecj03032]
 Prokaryotic Type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    JW5397 (hda)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DnaA AAA_16
Motif
Other DBs
NCBI-ProteinID: BAA16384
UniProt: P69931
Structure
PDB: 

Position
complement(2616731..2617477)
Genome map
AA seq 248 aa AA seqDB search
MVNFSRFCEILVEVSLNTPAQLSLPLYLPDDETFASFWPGDNSSLLAALQNVLRQEHSGY
IYLWAREGAGRSHLLHAACAELSQRGDAVGYVPLDKRTWFVPEVLDGMEHLSLVCIDNIE
CIAGDELWEMAIFDLYNRILESGKTRLLITGDRPPRQLNLGLPDLASRLDWGQIYKLQPL
SDEDKLQALQLRARLRGFELPEDVGRFLLKRLDREMRTLFMTLDQLDRASITAQRKLTIP
FVKEILKL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtggtaaacttctcgcgattttgtgaaatcctggttgaggtatctctgaacacaccggca
cagctctctttgccactttatcttcctgacgacgaaacctttgcaagtttctggccgggg
gataactcctctttactggccgcgctgcaaaacgtgctgcgtcaggaacatagcggttac
atctatctctgggcacgcgaaggcgcggggcgcagccatctgctgcacgcggcttgcgcg
gaattgtcgcagcgtggcgatgcggtgggctatgtcccgctggataaacgcacctggttt
gttccggaagtgctcgacggtatggagcatttgtcgctggtctgtatcgacaacattgag
tgtattgcaggcgatgagttgtgggagatggcgattttcgatctctacaatcgaattctg
gaatcgggcaaaacacggttgttgatcaccggcgatcgtccaccgcggcagttgaatctg
ggattaccggatctcgcgtcgcgactcgactgggggcagatctacaaattgcagccactt
tctgatgaagataagttgcaggcgctacagttacgcgcgcgtttgcgtggttttgaactg
ccggaagatgtggggcgtttcttgctgaagcggctcgacagagaaatgcgcacgctattt
atgacgttggatcagttggatcgtgcgtcgattaccgcgcaacgtaagctgaccattccg
tttgtgaaagaaattctgaagttgtag

DBGET integrated database retrieval system