KEGG   Escherichia coli K-12 W3110: JW5468Help
Entry
JW5468            CDS       T00068                                 

Gene name
ygfS
Definition
(GenBank) predicted oxidoreductase, 4Fe-4S ferredoxin-type subunit
Organism
ecj  Escherichia coli K-12 W3110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_9 Fer4 Fer4_11 Fer4_7 Fer4_10 Fer4_6 Fer4_2 Fer4_16 Fer4_3 Fer4_8 Fer4_4 Fer4_21 Fer4_17 Fer4_13 GF_recep_IV Fer4_20
Motif
Other DBs
NCBI-ProteinID: BAE76951
UniProt: Q46819
Position
complement(3027180..3027668)
Genome map
AA seq 162 aa AA seqDB search
MKSLIIVNPADCIGCRTCEVACVVAHPSEQELNADVFLPRLKVQRLDSISAPVMCHQCEN
APCVGACPVGALTMGEQVVQTNSARCIGCQSCVSACPFGMITIQSLPGDTRQQIVKCDLC
EQREEGPACVESCPTQALQLLTERELRRVRQQRIVASGENPL
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgttaattatcgttaatccggctgactgtattggctgccgtacttgtgaagta
gcctgtgtggtcgctcacccttcagaacaggagttgaatgccgatgtctttttaccccgg
ctgaaggtacagcgactggacagcatcagtgcgccggtgatgtgccatcagtgtgaaaac
gccccttgtgttggcgcttgccccgtgggggcgctgacgatgggcgagcaggtggtgcag
accaattctgcccgttgtattggctgtcagagttgcgtcagtgcgtgcccgtttggaatg
atcaccattcagtcgttgccgggggatacccgacaacaaattgtgaaatgcgatctctgt
gaacagcgggaagaggggccagcctgcgttgaatcttgcccaacacaggcgctgcagttg
cttactgaaagagaactcaggcgagtccgccagcagcgtattgttgccagcggtgagaat
cctctctga

DBGET integrated database retrieval system