KEGG   Escherichia coli K-12 W3110: JW5487
Entry
JW5487            CDS       T00068                                 

Gene name
glcE
Definition
(GenBank) glycolate oxidase FAD binding subunit
  KO
K11472  glycolate oxidase FAD binding subunit
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00630  Glyoxylate and dicarboxylate metabolism
ecj01100  Metabolic pathways
ecj01110  Biosynthesis of secondary metabolites
ecj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    JW5487 (glcE)
SSDB
Motif
Pfam: FAD_binding_4 FAD-oxidase_C
Other DBs
NCBI-ProteinID: BAE77039
UniProt: P52073
Position
complement(3124126..3125178)
AA seq 350 aa
MLRECDYSQALLEQVNQAISDKTPLVIQGSNSKAFLGRPVTGQTLDVRCHRGIVNYDPTE
LVITARVGTPLVTIEAALESAGQMLPCEPPHYGEEATWGGMVACGLAGPRRPWSGSVRDF
VLGTRIITGAGKHLRFGGEVMKNVAGYDLSRLMVGSYGCLGVLTEISMKVLPRPRASLSL
RREISLQEAMSEIAEWQLQPLPISGLCYFDNALWIRLEGGEGSVKAARELLGGEEVAGQF
WQQLREQQLPFFSLPGTLWRISLPSDAPMMDLPGEQLIDWGGALRWLKSTAEDNQIHRIA
RNAGGHATRFSAGDGGFAPLSAPLFRYHQQLKQQLDPCGVFNPGRMYAEL
NT seq 1053 nt   +upstreamnt  +downstreamnt
atgctacgcgagtgtgattacagccaggcgctgctggagcaggtgaatcaggcgattagc
gataaaacgccgctggtgattcagggcagcaatagcaaagcctttttaggtcgccctgtc
accgggcaaacgctggatgttcgttgtcatcgcggcattgttaattacgacccgaccgag
ctggtgataaccgcgcgtgtcggaacgccgctggtgacaattgaagcggcgctggaaagc
gcggggcaaatgctcccctgtgagccgccgcattatggtgaagaagccacctggggcggg
atggtcgcctgcgggctggcggggccgcgtcgcccgtggagcggttcggtccgcgatttt
gtcctcggcacgcgcatcattaccggcgctggaaaacatctgcgttttggtggcgaagtg
atgaaaaacgttgccggatacgatctctcacggttaatggtcggaagctacggttgtctt
ggcgtgctcactgaaatctcaatgaaagtgttaccgcgaccgcgcgcctccctgagcctg
cgtcgggaaatcagcctgcaagaagccatgagtgaaatcgccgagtggcaactccagcca
ttacccattagtggcttatgttacttcgacaatgcgttgtggatccgccttgagggcggc
gaaggatcggtaaaagcagcgcgtgaactgctgggtggcgaagaggttgccggtcagttc
tggcagcaattgcgtgaacaacaactgccgttcttctcgttaccaggtaccttatggcgc
atttcattacccagtgatgcgccgatgatggatttacccggcgagcaactgatcgactgg
ggcggggcgttacgctggctgaaatcgacagccgaggacaatcaaatccatcgcatcgcc
cgcaacgctggcggtcatgcgacccgctttagtgccggagatggtggctttgccccgcta
tcggctcctttattccgctatcaccagcagcttaaacagcagctcgacccttgcggcgtg
tttaaccccggtcgcatgtacgcggaactttga

DBGET integrated database retrieval system