KEGG   Escherichia coli K-12 W3110: JW5514
Entry
JW5514            CDS       T00068                                 

Gene name
ygjP
Definition
(GenBank) predicted metal dependent hydrolase
  KO
K07043  UTP pyrophosphatase [EC:3.6.1.-]
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    JW5514 (ygjP)
Enzymes [BR:ecj01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     JW5514 (ygjP)
SSDB
Motif
Pfam: DUF45 WLM T4_Rnl2_C
Other DBs
NCBI-ProteinID: BAE77135
UniProt: P42597
Position
3234616..3235119
AA seq 167 aa
MSNLTYLQGYPEQLLSQVRTLINEQRLGDVLAKRYPGTHDYATDKALWQYTQDLKNQFLR
NAPPINKVMYDNKIHVLKNALGLHTAVSRVQGGKLKAKVEIRVATVFRNAPEPFLRMIVV
HELAHLKEKEHNKAFYQLCCHMEPQYHQLEFDTRLWLTQLSLGQNKI
NT seq 504 nt   +upstreamnt  +downstreamnt
atgagcaatcttacttatcttcagggttatcccgagcagctactttcccaggtgcgaaca
ctgattaacgaacagcgtctgggcgatgtgctggcaaaacgctatccgggaacacacgac
tacgccaccgataaagccctctggcaatatactcaggatctgaaaaatcagtttctgcgt
aatgccccgccgatcaataaagtgatgtatgacaataagatccatgtgctaaaaaacgcg
ctcgggttacataccgctgtttctcgtgtgcagggcggcaagctgaaagcaaaggtggag
atccgcgtcgctaccgtgtttcgcaacgcgccggaaccgtttttgcgcatgatcgtggtg
cacgagctggcgcacctgaaggagaaagagcataacaaagcgttttaccagttgtgttgt
catatggaaccccagtaccaccagcttgagttcgacacccgactgtggctaacgcagttg
tcgcttgggcagaacaaaatctga

DBGET integrated database retrieval system