KEGG   Escherichia coli K-12 W3110: JW5550Help
Entry
JW5550            CDS       T00068                                 

Gene name
murI
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00471  D-Glutamine and D-glutamate metabolism
ecj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    JW5550 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ecj01011]
    JW5550 (murI)
Enzymes [BR:ecj01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     JW5550 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:ecj01011]
 Precursor biosynthesis
  Racemase
   JW5550 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: BAE77344
UniProt: P22634
Structure
PDB: 

Position
complement(3470396..3471253)
Genome map
AA seq 285 aa AA seqDB search
MATKLQDGNTPCLAATPSEPRPTVLVFDSGVGGLSVYDEIRHLLPDLHYIYAFDNVAFPY
GEKSEAFIVERVVAIVTAVQERYPLALAVVACNTASTVSLPALREKFDFPVVGVVPAIKP
AARLTANGIVGLLATRGTVKRSYTHELIARFANECQIEMLGSAEMVELAEAKLHGEDVSL
DALKRILRPWLRMKEPPDTVVLGCTHFPLLQEELLQVLPEGTRLVDSGAAIARRTAWLLE
HEAPDAKSADANIAFCMAMTPGAEQLLPVLQRYGFETLEKLAVLG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggctaccaaactgcaggacgggaatacaccttgtctggcagctacaccttctgaacca
cgtcccaccgtgctggtgtttgactccggcgtcggtgggttgtcggtctatgacgagatc
cggcatctcttaccggatctccattacatttatgctttcgataacgtcgctttcccgtat
ggcgaaaaaagcgaagcgtttattgttgagcgagtggtggcaattgtcaccgcggtgcaa
gaacgttatccccttgcgctggctgtggtcgcttgcaacactgccagtaccgtttcactt
cctgcattacgcgaaaagttcgacttcccggttgttggtgtcgtgccggcgattaaacct
gctgcacgtctgacggcaaatggcattgtcggattactggcaacccgcggaacagttaaa
cgttcttatactcatgagctgatcgcgcgtttcgctaatgaatgccagatagaaatgctg
ggctcggcagagatggttgagttggctgaagcgaagctacatggcgaagatgtttctctg
gatgcactaaaacgtatcctacgcccgtggttaagaatgaaagagccgccagataccgtt
gtattgggttgcacccatttccctctactacaagaagaactgttacaagtgctgccagag
ggaacccggctggtggattctggcgcagcgattgctcgccgaacggcctggttgttagaa
catgaagccccggatgcaaaatctgccgatgcgaatattgccttttgtatggcaatgacg
ccaggagctgaacaattattgcccgttttacagcgttacggcttcgaaacgctcgaaaaa
ctggcagttttaggctga

DBGET integrated database retrieval system