KEGG   Escherichia coli K-12 W3110: JW5551
Entry
JW5551            CDS       T00068                                 

Gene name
sthA
Definition
(GenBank) pyridine nucleotide transhydrogenase, soluble
  KO
K00322  NAD(P) transhydrogenase [EC:1.6.1.1]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00760  Nicotinate and nicotinamide metabolism
ecj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    JW5551 (sthA)
Enzymes [BR:ecj01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.1  With NAD+ or NADP+ as acceptor
    1.6.1.1  NAD(P)+ transhydrogenase (Si-specific)
     JW5551 (sthA)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_oxidored NAD_binding_8 FAD_binding_2 Thi4 GIDA HI0933_like AlaDh_PNT_C FAD_binding_3 DAO K_oxygenase 2-Hacid_dh_C
Other DBs
NCBI-ProteinID: BAE77349
UniProt: P27306
Position
3475891..3477291
AA seq 466 aa
MPHSYDYDAIVIGSGPGGEGAAMGLVKQGARVAVIERYQNVGGGCTHWGTIPSKALRHAV
SRIIEFNQNPLYSDHSRLLRSSFADILNHADNVINQQTRMRQGFYERNHCEILQGNARFV
DEHTLALDCPDGSVETLTAEKFVIACGSRPYHPTDVDFTHPRIYDSDSILSMHHEPRHVL
IYGAGVIGCEYASIFRGMDVKVDLINTRDRLLAFLDQEMSDSLSYHFWNSGVVIRHNEEY
EKIEGCDDGVIMHLKSGKKLKADCLLYANGRTGNTDSLALQNIGLETDSRGQLKVNSMYQ
TAQPHVYAVGDVIGYPSLASAAYDQGRIAAQALVKGEATAHLIEDIPTGIYTIPEISSVG
KTEQQLTAMKVPYEVGRAQFKHLARAQIVGMNVGTLKILFHRETKEILGIHCFGERAAEI
IHIGQAIMEQKGGGNTIEYFVNTTFNYPTMAEAYRVAALNGLNRLF
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgccacattcctacgattacgatgccatagtaataggttccggccccggcggcgaaggc
gctgcaatgggcctggttaagcaaggtgcgcgcgtcgcagttatcgagcgttatcaaaat
gttggcggcggttgcacccactggggcaccatcccgtcgaaagctctccgtcacgccgtc
agccgcattatagaattcaatcaaaacccactttacagcgaccattcccgactgctccgc
tcttcttttgccgatatccttaaccatgccgataacgtgattaatcaacaaacgcgcatg
cgtcagggattttacgaacgtaatcactgtgaaatattgcagggaaacgctcgctttgtt
gacgagcatacgttggcgctggattgcccggacggcagcgttgaaacactaaccgctgaa
aaatttgttattgcctgcggctctcgtccatatcatccaacagatgttgatttcacccat
ccacgcatttacgacagcgactcaattctcagcatgcaccacgaaccgcgccatgtactt
atctatggtgctggagtgatcggctgtgaatatgcgtcgatcttccgcggtatggatgta
aaagtggatctgatcaacacccgcgatcgcctgctggcatttctcgatcaagagatgtca
gattctctctcctatcacttctggaacagtggcgtagtgattcgtcacaacgaagagtac
gagaagatcgaaggctgtgacgatggtgtgatcatgcatctgaagtcgggtaaaaaactg
aaagctgactgcctgctctatgccaacggtcgcaccggtaataccgattcgctggcgtta
cagaacattgggctagaaactgacagccgcggacagctgaaggtcaacagcatgtatcag
accgcacagccacacgtttacgcggtgggcgacgtgattggttatccgagcctggcgtcg
gcggcctatgaccaggggcgcattgccgcgcaggcgctggtaaaaggcgaagccaccgca
catctgattgaagatatccctaccggtatttacaccatcccggaaatcagctctgtgggc
aaaaccgaacagcagctgaccgcaatgaaagtgccatatgaagtgggccgcgcccagttt
aaacatctggcacgcgcacaaatcgtcggcatgaacgtgggcacgctgaaaattttgttc
catcgggaaacaaaagagattctgggtattcactgctttggcgagcgcgctgccgaaatt
attcatatcggtcaggcgattatggaacagaaaggtggcggcaacactattgagtacttc
gtcaacaccacctttaactacccgacgatggcggaagcctatcgggtagctgcgttaaac
ggtttaaaccgcctgttttaa

DBGET integrated database retrieval system