ecj:JW5556; : No such data.

KEGG   Escherichia coli K-12 MG1655: b3945
Entry
b3945             CDS       T00007                                 

Gene name
gldA
Definition
(RefSeq) L-1,2-propanediol dehydrogenase/glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00561  Glycerolipid metabolism
eco00640  Propanoate metabolism
eco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    b3945 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    b3945 (gldA)
Enzymes [BR:eco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     b3945 (gldA)
SSDB
Motif
Pfam: Fe-ADH Fe-ADH_2
Other DBs
NCBI-GeneID: 948440
NCBI-ProteinID: NP_418380
Pasteur: gldA
RegulonDB: ECK120001833
ECOCYC: EG11904
ASAP: ABE-0012912
UniProt: P0A9S5
Structure
PDB: 
5ZXL

Position
complement(4137932..4139035)
AA seq 367 aa
MDRIIQSPGKYIQGADVINRLGEYLKPLAERWLVVGDKFVLGFAQSTVEKSFKDAGLVVE
IAPFGGECSQNEIDRLRGIAETAQCGAILGIGGGKTLDTAKALAHFMGVPVAIAPTIAST
DAPCSALSVIYTDEGEFDRYLLLPNNPNMVIVDTKIVAGAPARLLAAGIGDALATWFEAR
ACSRSGATTMAGGKCTQAALALAELCYNTLLEEGEKAMLAAEQHVVTPALERVIEANTYL
SGVGFESGGLAAAHAVHNGLTAIPDAHHYYHGEKVAFGTLTQLVLENAPVEEIETVAALS
HAVGLPITLAQLDIKEDVPAKMRIVAEAACAEGETIHNMPGGATPDQVYAALLVADQYGQ
RFLQEWE
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggaccgcattattcaatcaccgggtaaatacatccagggcgctgatgtgattaatcgt
ctgggcgaatacctgaagccgctggcagaacgctggttagtggtgggtgacaaatttgtt
ttaggttttgctcaatccactgtcgagaaaagctttaaagatgctggactggtagtagaa
attgcgccgtttggcggtgaatgttcgcaaaatgagatcgaccgtctgcgtggcatcgcg
gagactgcgcagtgtggcgcaattctcggtatcggtggcggaaaaaccctcgatactgcc
aaagcactggcacatttcatgggtgttccggtagcgatcgcaccgactatcgcctctacc
gatgcaccgtgcagcgcattgtctgttatctacaccgatgagggtgagtttgaccgctat
ctgctgttgccaaataacccgaatatggtcattgtcgacaccaaaatcgtcgctggcgca
cctgcacgtctgttagcggcgggtatcggcgatgcgctggcaacctggtttgaagcgcgt
gcctgctctcgtagcggcgcgaccaccatggcgggcggcaagtgcacccaggctgcgctg
gcactggctgaactgtgctacaacaccctgctggaagaaggcgaaaaagcgatgcttgct
gccgaacagcatgtagtgactccggcgctggagcgcgtgattgaagcgaacacctatttg
agcggtgttggttttgaaagtggtggtctggctgcggcgcacgcagtgcataacggcctg
accgctatcccggacgcgcatcactattatcacggtgaaaaagtggcattcggtacgctg
acgcagctggttctggaaaatgcgccggtggaggaaatcgaaaccgtagctgcccttagc
catgcggtaggtttgccaataactctcgctcaactggatattaaagaagatgtcccggcg
aaaatgcgaattgtggcagaagcggcatgtgcagaaggtgaaaccattcacaacatgcct
ggcggcgcgacgccagatcaggtttacgccgctctgctggtagccgaccagtacggtcag
cgtttcctgcaagagtgggaataa

DBGET integrated database retrieval system