KEGG   Escherichia coli K-12 W3110: JW5581Help
Entry
JW5581            CDS       T00068                                 

Gene name
ubiE
Definition
(GenBank) bifunctional 2-octaprenyl-6-methoxy-1,4-benzoquinone methylase and S-adenosylmethionine:2-DMK methyltransferase
  KO
K03183  demethylmenaquinone methyltransferase / 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase [EC:2.1.1.163 2.1.1.201]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00130  Ubiquinone and other terpenoid-quinone biosynthesis
ecj01100  Metabolic pathways
ecj01110  Biosynthesis of secondary metabolites
Module
ecj_M00116  Menaquinone biosynthesis, chorismate => menaquinone
ecj_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    JW5581 (ubiE)
Enzymes [BR:ecj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.163  demethylmenaquinone methyltransferase
     JW5581 (ubiE)
    2.1.1.201  2-methoxy-6-polyprenyl-1,4-benzoquinol methylase
     JW5581 (ubiE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ubie_methyltran Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_23 Methyltransf_12 PCMT UPF0020 MTS RrnaAD Methyltr_RsmB-F Methyltransf_8 MetW Rsm22 DREV GCD14 NNMT_PNMT_TEMT Methyltransf_15
Motif
Other DBs
NCBI-ProteinID: BAE77468
UniProt: P0A887
Position
complement(3617071..3617826)
Genome map
AA seq 251 aa AA seqDB search
MVDKSQETTHFGFQTVAKEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTIDCSG
VRRGQTVLDLAGGTGDLTAKFSRLVGETGKVVLADINESMLKMGREKLRNIGVIGNVEYV
QANAEALPFPDNTFDCITISFGLRNVTDKDKALRSMYRVLKPGGRLLVLEFSKPIIEPLS
KAYDAYSFHVLPRIGSLVANDADSYRYLAESIRMHPDQDTLKAMMQDAGFESVDYYNLTA
GVVALHRGYKF
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggtggataagtcacaagaaacgacgcactttggttttcagaccgtcgcgaaggaacaa
aaagcggatatggtcgcccacgttttccattccgtggcatcaaaatacgatgtcatgaat
gatttgatgtcatttggtattcatcgtttgtggaagcgattcacgattgattgcagcggc
gtacgccgtgggcagaccgtgctggatctggctggtggcaccggcgacctgacagcgaaa
ttctcccgcctggtcggagaaactggcaaagtggtccttgctgatatcaatgaatccatg
ctcaaaatgggccgcgagaagctgcgtaatatcggtgtgattggcaacgttgagtatgtt
caggcgaacgctgaggcgctgccgttcccggataacacctttgattgcatcaccatttcg
tttggtctgcgtaacgtcaccgacaaagataaagcactgcgttcaatgtatcgcgtgctg
aaacccggcggccgcctgctggtgcttgagttctcgaagccaattatcgagccgctgagc
aaagcctatgatgcatactccttccatgtgctgccgcgtattggctcactggtcgcgaac
gacgccgacagctaccgttatctggcagaatccatccgtatgcatcccgatcaggatacc
ctgaaagccatgatgcaggatgccggattcgaaagtgtcgactactacaatctgacggca
ggggttgtggcgctgcatcgtggttataagttctga

DBGET integrated database retrieval system