KEGG   Escherichia coli K-12 W3110: JW5585
Entry
JW5585            CDS       T00068                                 

Gene name
rhtB
Definition
(GenBank) neutral amino-acid efflux system
  KO
K05834  homoserine/homoserine lactone efflux protein
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW5585 (rhtB)
Transporters [BR:ecj02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   JW5585 (rhtB)
Motif
Pfam: LysE
Other DBs
NCBI-ProteinID: BAE77477
UniProt: P0AG34
Position
3627622..3628242
AA seq 206 aa
MTLEWWFAYLLTSIILSLSPGSGAINTMTTSLNHGYRGAVASIAGLQTGLAIHIVLVGVG
LGTLFSRSVIAFEVLKWAGAAYLIWLGIQQWRAAGAIDLKSLASTQSRRHLFQRAVFVNL
TNPKSIVFLAALFPQFIMPQQPQLMQYIVLGVTTIVVDIIVMIGYATLAQRIALWIKGPK
QMKALNKIFGSLFMLVGALLASARHA
NT seq 621 nt   +upstreamnt  +downstreamnt
atgaccttagaatggtggtttgcctacctgctgacatcgatcattttaagcctgtcgcca
ggctctggtgcaatcaacactatgaccacctcgctcaaccacggttatcgcggcgcggtg
gcgtctattgctgggcttcagaccggactggcgattcatattgtgctggttggcgtgggg
ttggggacgctattttcccgctcagtgattgcgtttgaagtgttgaagtgggcaggcgcg
gcttacttgatttggctgggaatccagcagtggcgcgccgctggtgcaattgaccttaaa
tcgctggcctctactcaatcgcgtcgacatttgttccagcgcgcagtttttgtgaatctc
accaatcccaaaagtattgtgtttctggcggcgctatttccgcaattcatcatgccgcaa
cagccgcaactgatgcagtatatcgtgctcggcgtcaccactattgtggtcgatattatt
gtgatgatcggttacgccacccttgctcaacggattgctctatggattaaaggaccaaag
cagatgaaggcgctgaataagattttcggctcgttgtttatgctggtgggagcgctgtta
gcatcggcgaggcatgcgtga

DBGET integrated database retrieval system