KEGG   Escherichia coli K-12 W3110: JW5604
Entry
JW5604            CDS       T00068                                 

Gene name
rep
Definition
(GenBank) DNA helicase and single-stranded DNA-dependent ATPase
  KO
K03656  ATP-dependent DNA helicase Rep [EC:3.6.4.12]
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ecj03400]
    JW5604 (rep)
Enzymes [BR:ecj01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     JW5604 (rep)
DNA repair and recombination proteins [BR:ecj03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   DNA helicases
    JW5604 (rep)
SSDB
Motif
Pfam: UvrD_C UvrD-helicase AAA_19 AAA_30 UvrD_C_2 Viral_helicase1 Exonuc_V_gamma
Other DBs
NCBI-ProteinID: BAE77520
UniProt: P09980
Position
complement(3673983..3676004)
AA seq 673 aa
MRLNPGQQQAVEFVTGPCLVLAGAGSGKTRVITNKIAHLIRGCGYQARHIAAVTFTNKAA
REMKERVGQTLGRKEARGLMISTFHTLGLDIIKREYAALGMKANFSLFDDTDQLALLKEL
TEGLIEDDKVLLQQLISTISNWKNDLKTPSQAAASAIGERDRIFAHCYGLYDAHLKACNV
LDFDDLILLPTLLLQRNEEVRKRWQNKIRYLLVDEYQDTNTSQYELVKLLVGSRARFTVV
GDDDQSIYSWRGARPQNLVLLSQDFPALKVIKLEQNYRSSGRILKAANILIANNPHVFEK
RLFSELGYGAELKVLSANNEEHEAERVTGELIAHHFVNKTQYKDYAILYRGNHQSRVFEK
FLMQNRIPYKISGGTSFFSRPEIKDLLAYLRVLTNPDDDSAFLRIVNTPKREIGPATLKK
LGEWAMTRNKSMFTASFDMGLSQTLSGRGYEALTRFTHWLAEIQRLAEREPIAAVRDLIH
GMDYESWLYETSPSPKAAEMRMKNVNQLFSWMTEMLEGSELDEPMTLTQVVTRFTLRDMM
ERGESEEELDQVQLMTLHASKGLEFPYVYMVGMEEGFLPHQSSIDEDNIDEERRLAYVGI
TRAQKELTFTLCKERRQYGELVRPEPSRFLLELPQDDLIWEQERKVVSAEERMQKGQSHL
ANLKAMMAAKRGK
NT seq 2022 nt   +upstreamnt  +downstreamnt
atgcgtctaaaccccggccaacaacaagctgtcgaattcgttaccggcccctgcctggtg
ctggcgggcgcgggttccggtaaaactcgtgttatcaccaataaaatcgcccatctgatc
cgcggttgcggttatcaggcgcggcacattgcggcggtgacctttactaataaagcagcg
cgcgagatgaaagagcgtgtagggcagacgctggggcgcaaagaggcgcgtgggctgatg
atctccactttccatacgttggggctggatatcatcaaacgcgagtatgcggcgcttggg
atgaaagcgaacttctcgttgtttgacgataccgatcagcttgctttgcttaaagagttg
accgaggggctgattgaagatgacaaagttctcctgcaacaactgatttcgaccatctct
aactggaagaatgatctcaaaacaccgtcccaggcggcagcaagtgcgattggcgagcgg
gaccgtatttttgcccattgttatgggctgtatgatgcacacctgaaagcctgtaacgtt
ctcgacttcgatgatctgattttattgccgacgttgctgctgcaacgcaatgaagaagtc
cgcaagcgctggcagaacaaaattcgctatctgctggtggatgagtatcaggacaccaac
accagccagtatgagctggtgaaactgctggtgggcagccgcgcgcgctttaccgtggtg
ggtgacgatgaccagtcgatctactcctggcgcggtgcacgtccgcaaaacctggtgctg
ctgagtcaggattttccggcgctgaaggtgattaagcttgagcagaactatcgctcttcc
gggcgtattctgaaagcggcgaacatcctgatcgccaataacccgcacgtctttgaaaag
cgtctgttctccgaactgggttatggcgcggagctaaaagtattaagcgcgaataacgaa
gaacatgaggctgagcgcgttactggcgagctgatcgcccatcacttcgtcaataaaacg
cagtacaaagattacgccattctttatcgcggtaaccatcagtcgcgggtgtttgaaaaa
ttcctgatgcaaaaccgcatcccgtacaaaatatctggtggtacgtcgtttttctctcgt
cctgaaatcaaggacttgctggcttatctgcgcgtgctgactaacccggacgatgacagc
gcatttctgcgtatcgttaacacgccgaagcgagagattggcccggctacgctgaaaaag
ctgggtgagtgggcgatgacgcgcaataaaagcatgtttaccgccagctttgatatgggc
ctgagtcagacgcttagcggacgtggttatgaagcattgacccgcttcactcactggttg
gcagaaatccagcgtctggcggagcgggagccgattgccgcggtgcgtgatctgatccat
ggcatggattatgaatcctggctgtacgaaacatcgcccagcccgaaagccgccgaaatg
cgcatgaagaacgtcaaccaactgtttagctggatgacggagatgctggaaggcagtgaa
ctggatgagccgatgacgctcacccaggtggtgacgcgctttactttgcgcgacatgatg
gagcgtggtgagagtgaagaagagctggatcaggtgcaactgatgactctccacgcgtcg
aaagggctggagtttccttatgtctacatggtcggtatggaagaagggtttttgccgcac
cagagcagcatcgatgaagataatatcgatgaggagcggcggctggcctatgtcggcatt
acccgcgcccagaaggaattgacctttacgctgtgtaaagaacgccgtcagtacggcgaa
ctggtgcgcccggagccgagccgctttttgctggagctgccgcaggatgatctgatttgg
gaacaggagcgcaaagtggtcagcgccgaagaacggatgcagaaagggcaaagccatctg
gcgaatctgaaagcgatgatggcggcaaaacgagggaaataa

DBGET integrated database retrieval system