KEGG   Escherichia coli K-12 W3110: JW5625Help
Entry
JW5625            CDS       T00068                                 

Gene name
gyrB
Definition
(GenBank) DNA gyrase, subunit B
  KO
K02470  DNA gyrase subunit B [EC:5.6.2.2]
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ecj03032]
    JW5625 (gyrB)
   03400 DNA repair and recombination proteins [BR:ecj03400]
    JW5625 (gyrB)
Enzymes [BR:ecj01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     JW5625 (gyrB)
DNA replication proteins [BR:ecj03032]
 Prokaryotic Type
  DNA Topoisomerases
   JW5625 (gyrB)
DNA repair and recombination proteins [BR:ecj03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      JW5625 (gyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_gyraseB GyrB_insert DNA_gyraseB_C HATPase_c Toprim HATPase_c_3 Spindle_Spc25
Motif
Other DBs
NCBI-ProteinID: BAE77595
UniProt: P0AES6
Structure
PDB: 

Position
3760296..3762710
Genome map
AA seq 804 aa AA seqDB search
MSNSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEII
VTIHADNSVSVQDDGRGIPTGIHPEEGVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVGV
SVVNALSQKLELVIQREGKIHRQIYEHGVPQAPLAVTGETEKTGTMVRFWPSLETFTNVT
EFEYEILAKRLRELSFLNSGVSIRLRDKRDGKEDHFHYEGGIKAFVEYLNKNKTPIHPNI
FYFSTEKDGIGVEVALQWNDGFQENIYCFTNNIPQRDGGTHLAGFRAAMTRTLNAYMDKE
GYSKKAKVSATGDDAREGLIAVVSVKVPDPKFSSQTKDKLVSSEVKSAVEQQMNELLAEY
LLENPTDAKIVVGKIIDAARAREAARRAREMTRRKGALDLAGLPGKLADCQERDPALSEL
YLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKARFDKMLSSQEVATLITALGCGIGR
DEYNPDKLRYHSIIIMTDADVDGSHIRTLLLTFFYRQMPEIVERGHVYIAQPPLYKVKKG
KQEQYIKDDEAMDQYQISIALDGATLHTNASAPALAGEALEKLVSEYNATQKMINRMERR
YPKAMLKELIYQPTLTEADLSDEQTVTRWVNALVSELNDKEQHGSQWKFDVHTNAEQNLF
EPIVRVRTHGVDTDYPLDHEFITGGEYRRICTLGEKLRGLLEEDAFIERGERRQPVASFE
QALDWLVKESRRGLSIQRYKGLGEMNPEQLWETTMDPESRRMLRVTVKDAIAADQLFTTL
MGDAVEPRRAFIEENALKAANIDI
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaattcttatgactcctccagtatcaaagtcctgaaagggctggatgcggtgcgt
aagcgcccgggtatgtatatcggcgacacggatgacggcaccggtctgcaccacatggta
ttcgaggtggtagataacgctatcgacgaagcgctcgcgggtcactgtaaagaaattatc
gtcaccattcacgccgataactctgtctctgtacaggatgacgggcgcggcattccgacc
ggtattcacccggaagagggcgtatcggcggcggaagtgatcatgaccgttctgcacgca
ggcggtaaatttgacgataactcctataaagtgtccggcggtctgcacggcgttggtgtt
tcggtagtaaacgccctgtcgcaaaaactggagctggttatccagcgcgagggtaaaatt
caccgtcagatctacgaacacggtgtaccgcaggccccgctggcggttaccggcgagact
gaaaaaaccggcaccatggtgcgtttctggcccagcctcgaaaccttcaccaatgtgacc
gagttcgaatatgaaattctggcgaaacgtctgcgtgagttgtcgttcctcaactccggc
gtttccattcgtctgcgcgacaagcgcgacggcaaagaagaccacttccactatgaaggc
ggcatcaaggcgttcgttgaatatctgaacaagaacaaaacgccgatccacccgaatatc
ttctacttctccactgaaaaagacggtattggcgtcgaagtggcgttgcagtggaacgat
ggcttccaggaaaacatctactgctttaccaacaacattccgcagcgtgacggcggtact
cacctggcaggcttccgtgcggcgatgacccgtaccctgaacgcctacatggacaaagaa
ggctacagcaaaaaagccaaagtcagcgccaccggtgacgatgcgcgtgaaggcctgatt
gcggtcgtttccgtgaaagtgccggacccgaaattctcctcccagaccaaagacaaactg
gtttcttctgaggtgaaatcggcggttgaacagcagatgaacgaactgctggcagaatac
ctgctggaaaacccaaccgacgcgaaaatcgtggttggcaaaattatcgatgctgcccgt
gcccgtgaagcggcgcgtcgcgcgcgtgaaatgacccgccgtaaaggtgcgctcgactta
gcgggcctgccgggcaaactggcagactgccaggaacgcgatccggcgctttccgaactg
tacctggtggaaggggactccgcgggcggctctgcgaagcaggggcgtaaccgcaagaac
caggcgattctgccgctgaagggtaaaatcctcaacgtcgagaaagcgcgcttcgataag
atgctctcttctcaggaagtggcgacgcttatcaccgcgcttggctgtggtatcggtcgt
gacgagtacaacccggacaaactgcgttatcacagcatcatcatcatgaccgatgcggac
gtcgacggctcgcacattcgtacgctgctgttgaccttcttctatcgtcagatgccggaa
atcgttgaacgcggtcacgtctacatcgctcagccgccgctgtacaaagtgaagaaaggc
aagcaggaacagtacattaaagacgacgaagcgatggatcagtaccagatctctatcgcg
ctggacggcgcaacgctgcacaccaacgccagtgcaccggcattggctggcgaagcgtta
gagaaactggtatctgagtacaacgcgacgcagaaaatgatcaatcgtatggagcgtcgt
tatccgaaagcaatgctgaaagagcttatctatcagccgacgttgacggaagctgacctt
tctgatgagcagaccgttacccgctgggtgaacgcgctggtcagcgaactgaacgacaaa
gaacagcacggcagccagtggaagtttgatgttcacaccaatgctgagcaaaacctgttc
gagccgattgttcgcgtgcgtacccacggtgtggatactgactatccgctggatcacgag
tttatcaccggtggcgaatatcgtcgtatctgcacgctgggtgagaaactgcgtggcttg
ctggaagaagatgcgtttatcgaacgtggcgagcgtcgtcagccggtagccagcttcgag
caggcgctggactggctggtgaaagagtcccgtcgcggcctctccatccagcgttataaa
ggtctgggcgagatgaacccggaacagctgtgggaaaccactatggacccggaaagtcgt
cgtatgctgcgcgttaccgttaaagatgcgattgctgccgaccagttgttcaccacgctg
atgggcgacgccgttgaaccgcgccgtgcgtttattgaagagaacgccctgaaagcggcg
aatatcgatatttaa

DBGET integrated database retrieval system