KEGG   Escherichia coli K-12 W3110: JW5644Help
Entry
JW5644            CDS       T00068                                 

Gene name
htrL
Definition
(GenBank) hypothetical protein
Organism
ecj  Escherichia coli K-12 W3110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HtrL_YibB
Motif
Other DBs
NCBI-ProteinID: BAE77674
UniProt: P25666
Position
3846732..3847589
Genome map
AA seq 285 aa AA seqDB search
MKSSTTIITAYFDIGRGDWTANKGFREKLARSVDVYFSYFERLAALENEMIIFTSPDLKP
RVEAIRNGKPTTVIVIDIKKKFRYIRSRIEKIQKDESFTNRLEPRQLKNPEYWSPEYVLV
CNLKAYFVNKAINMGLVKTPLVAWIDFGYCHKPNVTRGLKIWDFPFDESKMHLFTIKKGL
TVTSQQQVFDFMIGNHVYIIGGAIVGSQHKWKEFYKLVLESQKITLNNNIVDDDQGIFVM
CYYKRPDLFNLNYLGRGKWFDLFRCFRSNTLGAKMQALRIFLSRK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcatccaccacaattatcactgcatattttgacattggtagaggggattggact
gctaataaagggttccgtgaaaaactagctcgttcagttgatgtttattttagttacttt
gagcgtctggccgcacttgaaaatgagatgattattttcacttctcccgatttgaaacca
agggttgaagcgattcgcaacggaaaaccaacaacggttatcgttatcgatataaaaaag
aaatttagatatatcagaagtcgtatcgaaaaaattcaaaaagatgagtcgtttacaaat
agacttgagcctcgacaattaaaaaacccagagtactggtcaccagagtatgttttggta
tgtaaccttaaggcctattttgtaaataaagctatcaacatgggcttagtgaaaacgcct
cttgttgcgtggatagattttggctattgccataagccaaatgtaactcgaggattgaaa
atttgggatttcccatttgatgaaagtaagatgcatcttttcactataaaaaaagggctt
actgtcacatctcaacaacaggtttttgatttcatgattggcaatcatgtatatattatt
gggggcgcaattgttggttcacagcataaatggaaagaattctataaattagttctggaa
agtcaaaaaataacactaaataataacattgtggacgatgaccagggcatttttgtcatg
tgctattacaaacgccccgatctcttcaacctaaactatctggggagaggaaaatggttc
gatttgtttcgctgcttcaggagtaacactttaggggcaaaaatgcaggcgctgagaatt
ttcctttcaagaaaatag

DBGET integrated database retrieval system