KEGG   Escherichia coli K-12 W3110: JW5656Help
Entry
JW5656            CDS       T00068                                 

Gene name
tiaE
Definition
(GenBank) 2-keto-D-gluconate reductase
  KO
K00090  glyoxylate/hydroxypyruvate/2-ketogluconate reductase [EC:1.1.1.79 1.1.1.81 1.1.1.215]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00030  Pentose phosphate pathway
ecj00260  Glycine, serine and threonine metabolism
ecj00620  Pyruvate metabolism
ecj00630  Glyoxylate and dicarboxylate metabolism
ecj01100  Metabolic pathways
ecj01110  Biosynthesis of secondary metabolites
ecj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    JW5656 (tiaE)
   00620 Pyruvate metabolism
    JW5656 (tiaE)
   00630 Glyoxylate and dicarboxylate metabolism
    JW5656 (tiaE)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    JW5656 (tiaE)
Enzymes [BR:ecj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     JW5656 (tiaE)
    1.1.1.81  hydroxypyruvate reductase
     JW5656 (tiaE)
    1.1.1.215  gluconate 2-dehydrogenase
     JW5656 (tiaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: BAE77742
UniProt: P37666
Position
complement(3922131..3923105)
Genome map
AA seq 324 aa AA seqDB search
MKPSVILYKALPDDLLQRLQEHFTVHQVANLSPQTVEQNAAIFAEAEGLLGSNENVNAAL
LEKMPKLRATSTISVGYDNFDVDALTARKILLMHTPTVLTETVADTLMALVLSTARRVVE
VAERVKAGEWTASIGPDWYGTDVHHKTLGIVGMGRIGMALAQRAHFGFNMPILYNARRHH
KEAEERFNARYCDLDTLLQESDFVCLILPLTDETHHLFGAEQFAKMKSSAIFINAGRGPV
VDENALIAALQKGEIHAAGLDVFEQEPLSVDSPLLSMANVVAVPHIGSATHETRYGMAAC
AVDNLIDALQGKVEKNCVNPHVAD
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgtccgttatcctctacaaagccttacctgatgatttactgcaacgcctgcaa
gagcatttcaccgttcaccaggtggcaaacctcagcccacaaaccgtcgaacaaaatgca
gcaatttttgccgaagctgaaggtttactgggttcaaacgagaatgtaaatgccgcattg
ctggaaaaaatgccgaaactgcgtgccacatcaacgatctccgtcggctatgacaatttt
gatgtcgatgcgcttaccgcccgaaaaattctgctgatgcacacgccaaccgtattaaca
gaaaccgtcgccgatacgctgatggcgctggtgttgtctaccgctcgtcgggttgtggag
gtagcagaacgggtaaaagcaggcgaatggaccgcgagcataggcccggactggtacggc
actgacgttcaccataaaacactgggcattgtcgggatgggacggatcggcatggcgctg
gcacaacgtgcgcactttggcttcaacatgcccatcctctataacgcgcgccgccaccat
aaagaagcagaagaacgcttcaacgcccgctactgcgatttggatactctgttacaagag
tcagatttcgtttgcctgatcctgccgttaactgatgagacgcatcatctgtttggcgca
gaacaattcgccaaaatgaaatcctccgccattttcattaatgccggacgtggcccggtg
gttgacgaaaatgcactgatcgcagcattgcagaaaggcgaaattcacgctgccgggctg
gatgtcttcgaacaagagccactgtccgtagattcgccgttgctctcaatggccaacgtc
gtcgcagtaccgcatattggatctgccacccatgagacgcgttatggcatggccgcctgt
gccgtggataatttgattgatgcgttacaaggaaaggttgagaagaactgtgtgaatccg
cacgtcgcggactaa

DBGET integrated database retrieval system