KEGG   Escherichia coli K-12 W3110: JW5682Help
Entry
JW5682            CDS       T00068                                 

Gene name
dcrB
Definition
(GenBank) periplasmic protein
Organism
ecj  Escherichia coli K-12 W3110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DcrB DUF1454 PRODH
Motif
Other DBs
NCBI-ProteinID: BAE77821
UniProt: P0AEE1
Position
complement(4029903..4030460)
Genome map
AA seq 185 aa AA seqDB search
MRNLVKYVGIGLLVMGLAACDDKDTNATAQGSVAESNATGNPVNLLDGKLSFSLPADMTD
QSGKLGTQANNMHVWSDATGQKAVIVIMGDDPKEDLAVLAKRLEDQQRSRDPQLQVVTNK
AIELKGHKMQQLDSIISAKGQTAYSSVILGNVGNQLLTMQITLPADDQQKAQTTAENIIN
TLVIQ
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaatctggttaaatatgtcggaattggcctgctggttatggggcttgcggcctgt
gatgataaagacactaacgctacggcgcagggttcggtcgcggaaagtaacgctaccggg
aatcccgtcaacctgcttgatggcaagttaagtttctcgctgccagcggatatgaccgac
cagagcggtaagctgggaacgcaggccaataacatgcatgtctggtccgacgccaccggg
cagaaagcagtcatcgtcatcatgggcgatgatccgaaagaagatctggcggtgctggcg
aagcgtctggaagatcagcaacgtagccgcgatccgcagctgcaagtggtaaccaataaa
gccattgagctgaaaggtcacaaaatgcagcagttagacagtattatctccgcgaaaggc
cagacggcgtactcttccgttattctgggtaacgtgggtaatcaactgctgaccatgcaa
attacgctgcccgctgacgatcagcaaaaagcgcagaccaccgcagaaaacatcattaat
acgctggttattcagtaa

DBGET integrated database retrieval system