KEGG   Escherichia coli K-12 W3110: JW5702Help
Entry
JW5702            CDS       T00068                                 

Gene name
crp
Definition
(GenBank) DNA-binding transcriptional dual regulator
  KO
K10914  CRP/FNR family transcriptional regulator, cyclic AMP receptor protein
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02020  Two-component system
ecj02024  Quorum sensing
ecj02026  Biofilm formation - Escherichia coli
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    JW5702 (crp)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    JW5702 (crp)
   02026 Biofilm formation - Escherichia coli
    JW5702 (crp)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecj03000]
    JW5702 (crp)
Transcription factors [BR:ecj03000]
 Prokaryotic type
  Helix-turn-helix
   CRP/FNR family
    JW5702 (crp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: cNMP_binding HTH_Crp_2 Crp MarR_2 HTH_23 RepL HTH_36 MarR HTH_24 Sigma70_r4 HTH_7 Rrf2 HhH-GPD HTH_11 HTH_38 DUF4868 RPA_C
Motif
Other DBs
NCBI-ProteinID: BAE77933
UniProt: P0ACJ8
Structure
PDB: 

Position
complement(4153664..4154296)
Genome map
AA seq 210 aa AA seqDB search
MVLGKPQTDPTLEWFLSHCHIHKYPSKSKLIHQGEKAETLYYIVKGSVAVLIKDEEGKEM
ILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQ
MARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCS
RETVGRILKMLEDQNLISAHGKTIVVYGTR
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggtgcttggcaaaccgcaaacagacccgactctcgaatggttcttgtctcattgccac
attcataagtacccatccaagagcaagcttattcaccagggtgaaaaagcggaaacgctg
tactacatcgttaaaggctctgtggcagtgctgatcaaagacgaagagggtaaagaaatg
atcctctcctatctgaatcagggtgattttattggcgaactgggcctgtttgaagagggc
caggaacgtagcgcatgggtacgtgcgaaaaccgcctgtgaagtggctgaaatttcgtac
aaaaaatttcgccaattgattcaggtaaacccggacattctgatgcgtttgtctgcacag
atggcgcgtcgtctgcaagtcacttcagagaaagtgggcaacctggcgttcctcgacgtg
acgggccgcattgcacagactctgctgaatctggcaaaacaaccagacgctatgactcac
ccggacggtatgcaaatcaaaattacccgtcaggaaattggtcagattgtcggctgttct
cgtgaaaccgtgggacgcattctgaagatgctggaagatcagaacctgatctccgcacac
ggtaaaaccatcgtcgtttacggcactcgttaa

DBGET integrated database retrieval system