KEGG   Escherichia coli K-12 W3110: JW5738
Entry
JW5738            CDS       T00068                                 
Symbol
sugE
Name
(GenBank) multidrug efflux system protein
  KO
K11741  quaternary ammonium compound-resistance protein SugE
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW5738 (sugE)
Transporters [BR:ecj02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   JW5738 (sugE)
SSDB
Motif
Pfam: Multi_Drug_Res EamA DUF6541
Other DBs
NCBI-ProteinID: BAE78152
UniProt: P69937
Position
4381555..4381872
AA seq 105 aa
MSWIILVIAGLLEVVWAVGLKYTHGFSRLTPSVITVTAMIVSMALLAWAMKSLPVGTAYA
VWTGIGAVGAAITGIVLLGESANPMRLASLALIVLGIIGLKLSTH
NT seq 318 nt   +upstreamnt  +downstreamnt
atgtcctggattatcttagttattgctggtctgctggaagtggtatgggccgttggcctg
aaatatacccacggctttagtcgtttgacgccgagtgttattactgtgacggcgatgatt
gtcagtatggcgctacttgcctgggcgatgaaatcgttaccagtagggacggcttatgcc
gtgtggacgggtattggcgcagtcggcgcggccataaccggcattgtgctgctcggtgag
tccgctaacccgatgcgcctggcgagtctggcgttaatcgtattggggattattggtctg
aaactcagcactcactaa

DBGET integrated database retrieval system