KEGG   Escherichia coli K-12 W3110: JW5797
Entry
JW5797            CDS       T00068                                 

Gene name
yjjZ
Definition
(GenBank) hypothetical protein
Organism
ecj  Escherichia coli K-12 W3110
SSDB
Motif
Pfam: DUF1435
Other DBs
NCBI-ProteinID: BAE78358
UniProt: P55914
Position
4610484..4610720
AA seq 78 aa
MLQRTLGSGWGVLLPGLLIAGLMYADLSSDQWRIVILMGLVLTPMMLYHKQLRHYILLPS
CLALIAGIMLMIMNLNQG
NT seq 237 nt   +upstreamnt  +downstreamnt
atgttgcaacgtacgctgggcagtggctggggagtgttgctgccgggattgctgattgca
gggctgatgtatgcggatttatcgtcagatcagtggcggattgtcattctgatgggatta
gtattgacgccgatgatgctgtatcacaaacagttgcggcattacattttgctaccatcg
tgcctggcacttattgctggcatcatgctgatgataatgaatttgaatcagggatga

DBGET integrated database retrieval system