KEGG   Escherichia coli K-12 W3110: JW5805Help
Entry
JW5805            CDS       T00068                                 

Gene name
hyfI
Definition
(GenBank) hydrogenase 4, Fe-S subunit
  KO
K12144  hydrogenase-4 component I [EC:1.-.-.-]
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    JW5805 (hyfI)
Enzymes [BR:ecj01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     JW5805 (hyfI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_q6
Motif
Other DBs
NCBI-ProteinID: BAA16377
UniProt: P77668
Position
2609362..2610120
Genome map
AA seq 252 aa AA seqDB search
MSPVLTQHVSQPITLDEQTQKMKRHLLQDIRRSAYVYRVDCGGCNACEIEIFAAITPVFD
AERFGIKVVSSPRHADILLFTGAVTRAMRMPALRAYESAPDHKICVSYGACGVGGGIFHD
LYSVWGGSDTIVPIDVWIPGCPPTPAATIHGFAVALGLLQQKIHAVDYRDPTGVTMQPLW
PQIPPSQRIAIEREARRLAGYRQGREICDRLLRHLSDDPTGNRVNTWLRDADDPRLNSIV
QQLFRVLRGLHD
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagtccagtgcttacacaacatgtcagccagcccatcacgctggacgagcaaacgcaa
aagatgaagcggcatttgctacaggatatccgtcgctcggcttacgtttatcgcgtcgat
tgcggcggctgcaacgcctgtgaaatcgaaatttttgctgccattacaccagtattcgac
gcagaacgttttggcattaaggttgtttcatcaccgcgtcacgccgatattttgttattt
actggcgcagtcacccgggcgatgcgtatgcctgcacttcgggcgtatgagtctgccccc
gatcataaaatttgtgtttcctacggcgcgtgcggtgtcggcggcggtattttccacgat
ctctacagcgtctggggcggtagcgacaccattgtccccattgatgtttggatccccggc
tgcccgccaacaccggccgccaccattcacggtttcgccgtggcgctcggtttgctgcaa
cagaagattcacgctgtggattatcgcgatcccaccggggtgactatgcaaccgttgtgg
ccgcagatcccgccatcacagcgtatcgccattgagcgagaagcgcggcggctggcgggc
tatcgtcaggggcgagaaatttgcgatcggctcctgcgccatttaagcgacgatcctaca
ggaaatcgggttaacacctggttgcgcgatgccgacgatccacgtctcaatagtatcgtt
cagcaactctttcgcgtactccgggggttacatgactga

DBGET integrated database retrieval system