KEGG   Escherichia coli K-12 W3110: JW5818
Entry
JW5818            CDS       T00068                                 
Symbol
potG
Name
(GenBank) putrescine transporter subunit
  KO
K11076  putrescine transport system ATP-binding protein [EC:7.6.2.16]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    JW5818 (potG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW5818 (potG)
Enzymes [BR:ecj01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.16  ABC-type putrescine transporter
     JW5818 (potG)
Transporters [BR:ecj02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Putrescine transporter
    JW5818 (potG)
SSDB
Motif
Pfam: ABC_tran TOBE_2 AAA_21 RsgA_GTPase SMC_N AAA_16 AAA_22 AAA_28 AAA_29 Rad17 ATP-synt_ab MMR_HSR1 AAA_33 AAA_25 AAA_23 G-alpha
Other DBs
NCBI-ProteinID: BAA35566
UniProt: P31134
Position
895413..896546
AA seq 377 aa
MNDAIPRPQAKTRKALTPLLEIRNLTKSYDGQHAVDDVSLTIYKGEIFALLGASGCGKST
LLRMLAGFEQPSAGQIMLDGVDLSQVPPYLRPINMMFQSYALFPHMTVEQNIAFGLKQDK
LPKAEIASRVNEMLGLVHMQEFAKRKPHQLSGGQRQRVALARSLAKRPKLLLLDEPMGAL
DKKLRDRMQLEVVDILERVGVTCVMVTHDQEEAMTMAGRIAIMNRGKFVQIGEPEEIYEH
PTTRYSAEFIGSVNVFEGVLKERQEDGLVLDSPGLVHPLKVDADASVVDNVPVHVALRPE
KIMLCEEPPANGCNFAVGEVIHIAYLGDLSVYHVRLKSGQMISAQLQNAHRHRKGLPTWG
DEVRLCWEVDSCVVLTV
NT seq 1134 nt   +upstreamnt  +downstreamnt
gtgaatgacgctatccctcgcccgcaggcgaaaacccgtaaggcgctgacgccgctatta
gaaatccgcaacctgaccaaatcctacgatggtcaacatgcggtggatgatgtcagcctg
accatctacaaaggtgaaatcttcgcgctgctgggcgcatccggctgtggcaagtccacg
ctgctgcgtatgctggcaggtttcgaacaaccttctgccggacagataatgcttgatggc
gtcgatttgtcacaggttccgccttacctgcgccccatcaatatgatgtttcagtcttac
gcgctgtttccgcatatgaccgtggaacagaacatcgcttttggcctgaaacaggacaaa
ctaccgaaagcggaaattgccagccgggtcaatgagatgctcggcctggtgcatatgcag
gagttcgccaaacgcaaaccgcatcagctttccggtggtcagcgacaacgtgtggccctg
gcccgaagccttgcgaagcgcccgaaactattactgctcgatgagccgatgggcgcgctg
gataaaaagctgcgtgacaggatgcagcttgaagtggtggatattctggagcgcgtcggt
gtgacttgtgtgatggtcacccacgatcaggaagaggcgatgaccatggcggggcgcatc
gccattatgaatcgtgggaaatttgtccagattggcgaaccggaagagatctacgagcat
ccgactacccgctatagcgccgaatttattggctcggtaaacgtctttgaaggcgtactc
aaagagcgtcaggaagatggcctggtgcttgattcgccggggctggtgcatccactgaaa
gtcgacgcggatgcctcggtggtcgataacgtgccggtacatgtggcgctgcgcccggaa
aaaatcatgctttgcgaagagccgcccgccaatggttgtaacttcgcggtgggggaggtg
atacacattgcctatctcggcgatctttcggtgtatcacgttcgtctgaaaagtgggcag
atgattagcgcccagctacaaaacgcccatcgtcatcgtaaagggttaccgacctggggc
gacgaagtgcgtttgtgctgggaagtggacagctgtgtggtgctgacggtttaa

DBGET integrated database retrieval system