KEGG   Escherichia coli K-12 W3110: JW5876
Entry
JW5876            CDS       T00068                                 

Gene name
yfeH
Definition
(GenBank) predicted inner membrane protein
  KO
K14347  solute carrier family 10 (sodium/bile acid cotransporter), member 7
Organism
ecj  Escherichia coli K-12 W3110
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW5876 (yfeH)
   04147 Exosome [BR:ecj04147]
    JW5876 (yfeH)
Transporters [BR:ecj02000]
 Solute carrier family (SLC)
  SLC10: Sodium bile salt cotransporter
   JW5876 (yfeH)
Exosome [BR:ecj04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   JW5876 (yfeH)
SSDB
Motif
Pfam: SBF_like SBF
Other DBs
NCBI-ProteinID: BAA16281
UniProt: P39836
Position
2532392..2533390
AA seq 332 aa
MKLFRILDPFTLTLITVVLLASFFPARGDFVPFFENLTTAAIALLFFMHGAKLSREAIIA
GGGHWRLHLWVMCSTFVLFPILGVLFAWWKPVNVDPMLYSGFLYLCILPATVQSAIAFTS
MAGGNVAAAVCSASASSLLGIFLSPLLVGLVMNVHGAGGSLEQVGKIMLQLLLPFVLGHL
SRPWIGDWVSRNKKWIAKTDQTSILLVVYTAFSEAVVNGIWHKVGWGSLLFIVVVSCVLL
AIVIVVNVFMARRLSFNKADEITIVFCGSKKSLANGIPMANILFPTSVIGMMVLPLMIFH
QIQLMVCAVLARRYKRQTEQLQAQQESSADKA
NT seq 999 nt   +upstreamnt  +downstreamnt
atgaaactttttcgtatcctcgatcctttcaccttaaccctgatcacggtggtgttgctg
gcctctttctttccggccagaggcgatttcgtccccttctttgaaaatctgaccaccgca
gctattgccctgctgttctttatgcacggcgcgaagttgtcgcgtgaggcgattattgct
ggcggtggtcactggcgactgcatttgtgggtaatgtgcagcaccttcgtgctgtttccg
attctgggtgtactgtttgcctggtggaaaccggtaaatgtcgacccgatgctctactcc
ggttttctctacttgtgcattctcccggctaccgtgcagtctgcaatcgccttcacgtca
atggcgggcggtaacgtcgcggcagcggtttgttctgcgtcggcatccagcctgctgggg
attttcctttcaccattgctggttggtctggtgatgaatgttcacggtgcagggggcagc
cttgagcaggtcggtaaaattatgctgcaactgctgctgccgtttgtgttggggcatctt
tcccggccgtggattggtgactgggtgtcgcgcaataaaaaatggattgcgaaaactgac
cagacgtccattctgttggtggtttatacagcgttcagcgaagccgtcgttaatggtatc
tggcataaagttggctggggatcattgctgtttatcgtggtggtcagctgcgttcttctg
gctatcgtgattgtagttaacgtctttatggcacgccgactgagcttcaataaggcagat
gaaattactatcgtcttttgtggttcgaaaaagagtctggcaaatggcatcccgatggca
aacattctgttccccacatcggtgatcggtatgatggtgctgcccctgatgattttccat
cagatccaattgatggtctgtgcggtgctggcgcgtcgatacaaacgccagaccgaacag
ttacaggcgcagcaggaaagcagcgccgataaagcttaa

DBGET integrated database retrieval system