KEGG   Escherichia coli K-12 W3110: JW5940
Entry
JW5940            CDS       T00068                                 
Symbol
bisC
Name
(GenBank) biotin sulfoxide reductase
  KO
K08351  biotin/methionine sulfoxide reductase [EC:1.-.-.-]
Organism
ecj  Escherichia coli K-12 W3110
Pathway
ecj00780  Biotin metabolism
ecj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    JW5940 (bisC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecj02000]
    JW5940 (bisC)
Enzymes [BR:ecj01000]
 1. Oxidoreductases
  1.-  
   1.-.-
    1.-.-.-
     JW5940 (bisC)
Transporters [BR:ecj02000]
 Other transporters
  Transmembrane electron carriers [TC:5]
   JW5940 (bisC)
SSDB
Motif
Pfam: Molybdopterin Molydop_binding
Other DBs
NCBI-ProteinID: BAE77744
UniProt: P20099
Position
3924075..3926354
AA seq 759 aa
MLVETDGETVFSSRGALATGMENSLQSAVRDQVHSNTRVRFPMVRKGFLASPENPQGIRG
QDEFVRVSWDEALDLIHQQHKRIREAYGPASIFAGSYGWRSNGVLHKASTLLQRYMALAG
GYTGHLGDYSTGAAQAIMPYVVGGSEVYQQQTSWPLVLEHSDVVVLWSANPLNTLKIAWN
ASDEQGLSYFSALRDSGKKLICIDPMRSETVDFFGDKMEWVAPHMGTDVALMLGIAHTLV
ENGWHDEAFLARCTTGYAVFASYLLGESDGIAKTAEWAAEICGVGAAKIRELAAIFHQNT
TMLMAGWGMQRQQFGEQKHWMIVTLAAMLGQIGTPGGGFGLSYHFANGGNPTRRSAVLSS
MQGSLPGGCDAVDKIPVARIVEALENPGGAYQHNGMNRHFPDIRFIWWAGGANFTHHQDT
NRLIRAWQKPELVVISECFWTAAAKHADIVLPATTSFERNDLTMTGDYSNQHLVPMKQVV
PPRYEARNDFDVFAELSERWEKGGYARFTEGKSELQWLETFYNVARQRGASQQVELPPFA
EFWQANQLIEMPENPDSERFIRFADFCRDPLAHPLKTASGKIEIFSQRIADYGYPDCPGH
PMWLEPDEWQGNAEPEQLQVLSAHPAHRLHSQLNYSSLRELYAVANREPVTIHPDDAQER
GIQDGDTVRLWNARGQILAGAVISEGIKPGVICIHEGAWPDLDLTADGICKNGAVNVLTK
DLPSSRLGNGCAGNTALAWLEKYNGPELTLTAFEPPASS
NT seq 2280 nt   +upstreamnt  +downstreamnt
atgctggttgaaaccgacggcgaaaccgtgtttagctcgcgtggcgcgttagccacagga
atggaaaactccttgcagagcgcggttcgcgaccaggttcacagcaatacgcgggtacga
tttccaatggtgcgaaaaggctttcttgcgtcaccggaaaacccgcaaggcattcgtggg
caggatgaatttgttcgcgtgagttgggatgaggcgctggatcttattcaccaacaacat
aaacgcattcgtgaggcttatggtccggcatcgatttttgctggttcctacggctggcgt
tcaaacggcgtgctgcataaggcctcgacattattacaacgctatatggcgctggcaggc
ggttataccgggcatctgggggattattcgaccggcgcggcacaggcgatcatgccgtat
gtcgtgggtggtagtgaagtttatcaacagcagaccagttggccgctggtgctggaacat
agcgatgtcgtggtgctgtggagtgctaacccactcaatacgctgaaaattgcgtggaat
gcatccgatgagcaggggctttcttacttttctgcactgcgtgacagcgggaaaaagctg
atctgcattgatccaatgcgatcggaaaccgtcgatttctttggcgataaaatggagtgg
gtggcaccgcacatgggcaccgatgttgcgctgatgctggggatcgcccatacgctggtg
gaaaatggttggcacgacgaagcgtttctggcgcgttgcaccacaggttatgccgtcttc
gcctcttatttgctgggcgagagtgacggaatagcgaaaaccgccgaatgggcagcagag
atttgtggtgttggcgcagcgaaaatccgcgagctggcggctattttccaccaaaatacc
accatgctgatggcaggctggggaatgcagcgccaacagtttggtgagcaaaaacactgg
atgatcgtcacgctggcagcaatgttggggcaaatcggcacacccggcggcggttttggt
ctttcttaccattttgccaatggtggtaaccccacgcggcgttctgcggtgctctcttcc
atgcagggcagcttgccgggtggctgcgatgcggtggataaaatccctgttgcccgcatt
gttgaagcactggaaaaccctggtggcgcatatcaacacaacggtatgaaccgacatttc
ccggatattcgttttatctggtgggcgggcggtgccaactttactcatcatcaggatacc
aatcgcctgatccgtgcctggcaaaaaccggagctggtggtgatctctgaatgcttctgg
acggcggcggcaaaacacgcggatatcgttctgcctgcgactacctcttttgagcgtaat
gatctcaccatgaccggtgattacagtaatcagcatctggtgccgatgaagcaagtggtg
ccgccacgctatgaagcgcgtaatgattttgatgtttttgccgagttaagtgaacgctgg
gagaagggcggttatgcacgttttacggaaggaaaaagtgagctgcaatggctggaaacg
ttttataacgttgcccgacagcgcggggcaagccagcaggttgaattgccgccatttgct
gagttctggcaagccaaccagttaattgagatgccggaaaacccggacagcgagcggttt
attcgcttcgctgatttttgccgcgatccgctggcgcatccgttaaaaaccgccagcggc
aagattgaaatcttctcacagcgtattgccgattacggttacccggattgccctgggcat
ccaatgtggctggagccggacgaatggcagggcaatgccgaaccagaacagttgcaggta
ctttctgcccatccggcgcaccgcctgcacagccagctgaattacagttctctgcgcgaa
ttgtacgcggtggcaaatcgtgagcctgtcaccattcatcctgacgatgcccaggagcgc
ggcatacaagatggcgatactgttcggttgtggaacgcacgcgggcaaattcttgccgga
gcggtcattagcgagggaattaaacctggcgtgatttgcattcacgaaggggcatggccg
gatctggatttaaccgctgacggtatttgtaaaaacggcgcagtgaacgtgctgaccaaa
gatctccccagctcgcggctggggaatggctgtgcgggtaatacggcgctggcatggctg
gaaaaatacaacggtccggaactgacacttacagcgtttgaaccaccggccagctcataa

DBGET integrated database retrieval system