KEGG   Escherichia coli 55989 (EAEC): EC55989_0226Help
Entry
EC55989_0226      CDS       T00826                                 

Definition
(GenBank) conserved hypothetical protein, putative lipoprotein
  KO
K11906  type VI secretion system protein VasD
Organism
eck  Escherichia coli 55989 (EAEC)
Pathway
eck03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eck00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EC55989_0226
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eck02044]
    EC55989_0226
Secretion system [BR:eck02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EC55989_0226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS-SciN
Motif
Other DBs
NCBI-ProteinID: CAU96105
UniProt: B7LHD2
Position
complement(254335..254859)
Genome map
AA seq 174 aa AA seqDB search
MNRKAFLACVLMCVILTGCETAKKISEVIKNPDIQVGSLKEQPSEITVTLLTEPDTNTNA
EGESAAVDVQLVYLTDDSKLLAADYDQIASTPLPDVLGKNYIDHQDFNLLPDTIKTLPPV
KLDEKTQFIGVVAYFSDDQATEWKQIETVEGTGHHYRLLVHVRQSSIEMKKEDE
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaacaggaaggcgtttctggcctgcgtgctgatgtgcgtcatattaaccggctgcgaa
acggcgaaaaaaatcagtgaggtgatcaaaaacccggatatccaggtcgggagcctgaag
gagcaaccttcggaaataaccgtcaccctgctgaccgaaccggacaccaataccaatgcg
gaaggtgaatcagccgccgtggatgtgcaactggtgtacctgactgacgactcaaaattg
ctggcagccgactatgaccagatagccagtacgccgctaccggatgtgctgggtaaaaac
tatatcgaccaccaggatttcaacctgttgccggacaccatcaaaaccctgccgccggta
aagctggatgagaaaacgcagtttattggtgtcgtggcctatttctccgatgaccaggcc
actgaatggaaacaaatcgagacggtggaaggaaccggccaccattaccgcctgctggtg
catgtacgtcaaagcagcatcgaaatgaaaaaagaggatgaataa

DBGET integrated database retrieval system