KEGG   Escherichia coli 55989 (EAEC): EC55989_0358Help
Entry
EC55989_0358      CDS       T00826                                 

Gene name
mhpF
Definition
(GenBank) acetaldehyde-CoA dehydrogenase II, NAD-binding
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
eck  Escherichia coli 55989 (EAEC)
Pathway
eck00360  Phenylalanine metabolism
eck00362  Benzoate degradation
eck00620  Pyruvate metabolism
eck00621  Dioxin degradation
eck00622  Xylene degradation
eck00650  Butanoate metabolism
eck01100  Metabolic pathways
eck01120  Microbial metabolism in diverse environments
eck01220  Degradation of aromatic compounds
Module
eck_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:eck00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    EC55989_0358 (mhpF)
   00650 Butanoate metabolism
    EC55989_0358 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    EC55989_0358 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EC55989_0358 (mhpF)
   00622 Xylene degradation
    EC55989_0358 (mhpF)
   00621 Dioxin degradation
    EC55989_0358 (mhpF)
Enzymes [BR:eck01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     EC55989_0358 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh F420_oxidored GFO_IDH_MocA Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: CAU96235
UniProt: B7L507
Position
399100..400050
Genome map
AA seq 316 aa AA seqDB search
MSKRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPQSDGLARARRMGVATTHEGVI
GLMNMPEFADIDIVFDATSAGAHVKNDAALREAKPDIRLIDLTPAAIGPYCVPVVNLEAN
VDQLNVNMVTCGGQATIPMVAAVSRVARVHYAEIIASIASKSAGPGTRANIDEFTETTSR
AIEVVGGAAKGKAIIVLNPAEPPLMMRDTVYVLSDEASQDDIEASINEMAEAVQAYVPGY
RLKQRVQFEVIPQDKPVNLPGVGQFSGLKTAVWLEVEGAAHYLPAYAGNLDIMTSSALAT
AEKMAQSLARKAGEAA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagcgtaaagtcgccattatcggttctggcaacattggcaccgatctgatgatt
aaaattttgcgtcacggtcagcatctggagatggcggtgatggtcggcattgatcctcag
tccgacggtctggcgcgtgccagacgtatgggcgtcgccaccacccatgaaggggtgatc
gggctgatgaacatgcctgaatttgctgatatcgacattgtatttgatgcgaccagcgcg
ggcgcgcatgtgaaaaacgatgccgctttacgcgaagcgaaaccggatattcgcttaatt
gacctgacgcctgctgccatcggcccttactgcgtgccggtggttaacctcgaggcgaac
gtcgatcaactgaacgtcaacatggtcacctgcggcggccaggccaccattccaatggtg
gcggcagtttcacgcgtggcgcgtgttcattacgccgaaattatcgcttctatcgccagt
aaatctgccggacctggcacgcgtgccaatatcgatgaatttacggaaaccacttcccga
gccattgaagtggtgggcggcgcggcaaaagggaaggcgattattgtgcttaacccagca
gagccaccgttgatgatgcgtgacacggtgtatgtattgagcgacgaagcttcacaagat
gatatcgaagcctcaatcaatgaaatggctgaggcggtgcaggcttacgtaccgggttat
cgcctgaaacagcgcgtgcagtttgaagttatcccgcaggataaaccggtcaatttaccg
ggcgtggggcaattctccggactgaaaacagcggtctggctggaagtcgaaggcgcagcg
cattatctgcctgcctatgcgggcaacctcgacattatgacttccagtgcgctggcgaca
gcggaaaaaatggcccagtcactggcgcgcaaggcaggagaagcggcatga

DBGET integrated database retrieval system