KEGG   Escherichia coli 55989 (EAEC): EC55989_1914Help
Entry
EC55989_1914      CDS       T00826                                 

Gene name
astD
Definition
(GenBank) succinylglutamic semialdehyde dehydrogenase
  KO
K06447  succinylglutamic semialdehyde dehydrogenase [EC:1.2.1.71]
Organism
eck  Escherichia coli 55989 (EAEC)
Pathway
eck00330  Arginine and proline metabolism
eck01100  Metabolic pathways
Module
eck_M00879  Arginine succinyltransferase pathway, arginine => glutamate
Brite
KEGG Orthology (KO) [BR:eck00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    EC55989_1914 (astD)
Enzymes [BR:eck01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.71  succinylglutamate-semialdehyde dehydrogenase
     EC55989_1914 (astD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CAU97773
UniProt: B7L6M0
Position
complement(1976688..1978166)
Genome map
AA seq 492 aa AA seqDB search
MTLWINGDWITGQGASRVKRNPVSGEVLWQGNDADAAQVEQACRAARAAFPRWARLSLAE
RQVVVERFAGLLERNKGELTAIIARETGKPRWEAATEVTAMINKIAISIKAYHVRTGEQR
SEMPDGAASLRHRPHGVLAVFGPYNFPGHLPNGHIVPALLAGNTIIFKPSELTPWSGEAV
MRLWQQAGLPPGVLNLVQGGRETGQALSALEDLDGLLFTGSANTGYQLHRQLSGQPEKIL
ALEMGGNNPLIIDEVADIDAAVHLTIQSAFVTAGQRCTCARRLLLKSGAQGDAFLARLVA
VSQRLTPGNWDDEPQPFIGGLISEQAAQQVVTAWQQLEAMGGRTLLAPRLLQSETSLLTP
GIIEMTGVAGVPDEEVFGPLLRVWRYDSFEEAILMANNTRFGLSCGLVSPEREKFDQLLL
EARAGIVNWNKPLTGAASTAPFGGIGASGNHRPSAWYAADYCAWPMASLESDSLTLPATL
NPGLDFSDEVVR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgactttatggattaacggtgactggataacgggccagggcgcatcgcgtgtgaagcgt
aatccggtatcgggcgaggtgttatggcaaggcaatgatgccgatgccgctcaggtcgaa
caggcttgtcgggcagcccgtgcggcgtttccgcgctgggcgcggctctcattggctgaa
cgtcaggtcgttgtcgaacgctttgccggattgctggaaaggaataaaggcgaattaacc
gcgattattgccagagaaacgggtaagccgcgctgggaagcggcaaccgaagtgacggcg
atgatcaataaaatcgcgatatcaattaaggcgtatcacgttcgtaccggcgagcagcgt
agtgaaatgccggacggtgcggcgagcctgcgacatcgcccgcacggcgtgctggcggtg
tttgggccgtataatttccctggtcatttgccgaacggacatatcgttccggcattgctg
gcaggtaacaccattatctttaaacccagcgaactgacaccgtggagtggcgaagcggta
atgcgtttatggcagcaggctggcttgccgccgggcgtactgaacctggtgcagggcggg
cgtgaaacgggtcaggcgctgagtgcgctggaggatctcgacggtttgctgtttaccggt
agcgccaataccggctaccagctgcatcgccagctctccggtcagccggagaaaattctc
gcccttgagatgggcggtaataatccgctaattatcgatgaggtggcggatatcgacgcg
gctgtccatctgaccattcagtcggcgtttgtcacagccgggcaacgctgcacctgcgcc
cgccgtttattgctcaaaagcggagcgcagggcgatgcgtttcttgctcgtctggttgcc
gtcagccagcgattaacgccgggcaactgggatgacgaaccgcagccgtttattggcggg
ctgatttctgaacaggccgcacagcaggtggttactgcctggcagcaactggaagcgatg
ggcggacgaaccctgcttgcgccgcgcttattacaatcagagacatcgttgctgacgccg
gggatcattgaaatgacaggcgttgctggcgtaccagatgaagaggtgttcggaccgtta
ttgcgcgtctggcgttatgattctttcgaggaagcgattctaatggcgaataacactcgc
ttcggactctcttgcggtctggtttcccccgagcgggaaaaattcgatcaactgttgctg
gaggcgcgggcggggattgttaactggaacaaaccgcttactggtgctgccagtaccgcg
ccattcggcggcattggtgcatccggtaaccatcgccccagcgcctggtatgccgcagat
tactgcgcatggcctatggcgagcctggagtcggactcgttaactttgcccgcaacgctt
aaccccgggctggatttttccgatgaggtggtgcgatga

DBGET integrated database retrieval system