KEGG   Escherichia coli 55989 (EAEC): EC55989_2656Help
Entry
EC55989_2656      CDS       T00826                                 

Gene name
cscA
Definition
(GenBank) Sucrose-6-phosphate hydrolase (beta-fructofuranosidase) (Sucrase) (Invertase)
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
eck  Escherichia coli 55989 (EAEC)
Pathway
eck00052  Galactose metabolism
eck00500  Starch and sucrose metabolism
eck01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eck00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    EC55989_2656 (cscA)
   00500 Starch and sucrose metabolism
    EC55989_2656 (cscA)
Enzymes [BR:eck01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     EC55989_2656 (cscA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-ProteinID: CAU98523
UniProt: B7LBR6
Position
2708671..2710113
Genome map
AA seq 480 aa AA seqDB search
MIKMTQSRLHAAQNALAKLHEHRGNTFYPHFHLAPPAGWMNDPNGLIWFNDRYHAFYQHH
PMSEHWGPMHWGHATSDDMIHWQHEPIALAPGDDNDKDGCFSGSAVDDNGVLSLIYTGHV
WLDGAGNDDAIREVQCLATSRDGIHFEKQGVILTPPEGIMHFRDPKVWREADTWWMVVGA
KDPGNTGQILLYRGSSLREWTFDRVLAHADAGESYMWECPDFFSLGDQHYLMFSPQGMNA
EGYSYRNRFQSGVIPGMWSPGRLFAQSGHFTELDNGHDFYAPQSFLAKDGRRIVIGWMDM
WESPMPSKREGWAGCMTLARELSESNGKLLQRPVHEAESLRQQHQSVSPRTISNKYVLQE
NAQAVEIQLQWALKNSDAEHYGLQLGTGMRLYIDNQSERLVLWRYYPHENLDGYRSIPLP
QRDTLALRIFIDTSSVEVFINDGEAVMSSRIYPQPEERELSLYASHGVAVLQHGALWLLG
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaatgacgcaatctcgattgcatgcggcgcaaaacgccctagcaaaacttcat
gagcaccggggtaacactttctatccccattttcacctcgcgcctcctgccgggtggatg
aacgatccaaacggcctgatctggtttaacgatcgttatcacgcgttttatcaacatcat
ccgatgagcgaacactgggggccaatgcactggggacatgccaccagcgacgatatgatc
cactggcagcatgagcctattgcgttagcgccaggagacgataatgacaaagacgggtgt
ttttcaggtagtgctgtcgatgacaatggtgtcctctcacttatctacaccggacacgtc
tggctcgatggtgcaggtaatgacgatgcaattcgcgaagtacaatgtctggctaccagt
cgggatggtattcatttcgagaaacagggtgtgatcctcactccaccagaaggaatcatg
cacttccgcgatcctaaagtgtggcgtgaagccgacacatggtggatggtagtcggggcg
aaagatccaggcaacacggggcagatcctgctttatcgcggcagttcgttgcgtgaatgg
accttcgatcgcgtactggcccacgctgatgcgggtgaaagctatatgtgggaatgtccg
gactttttcagccttggcgatcagcattatctgatgttttccccgcagggaatgaatgcc
gagggatacagttaccgaaatcgctttcaaagtggcgtaatacccggaatgtggtcgcca
ggacgactttttgcacaatccgggcattttactgaacttgataacgggcatgacttttat
gcaccacaaagctttttagcgaaggatggtcggcgtattgttatcggctggatggatatg
tgggaatcgccaatgccctcaaaacgtgaaggatgggcaggctgcatgacgctggcgcgc
gagctatcagagagcaatggcaaacttctacaacgcccggtacacgaagctgagtcgtta
cgccagcagcatcaatctgtctctccccgcacaatcagcaataaatatgttttgcaggaa
aacgcgcaagcagttgagattcagttgcagtgggcgctgaagaacagtgatgccgaacat
tacggattacagctcggcactggaatgcggctgtatattgataaccaatctgagcgactt
gttttgtggcggtattacccacacgagaatttagacggctaccgtagtattcccctcccg
cagcgtgacacgctcgccctaaggatatttatcgatacatcatccgtggaagtatttatt
aacgacggggaagcggtgatgagtagtcgaatctatccgcagccagaagaacgggaactg
tcgctttatgcctcccacggagtggctgtgctgcaacatggagcactctggctactgggt
taa

DBGET integrated database retrieval system