KEGG   Escherichia coli 55989 (EAEC): EC55989_2684Help
Entry
EC55989_2684      CDS       T00826                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
eck  Escherichia coli 55989 (EAEC)
Pathway
eck00010  Glycolysis / Gluconeogenesis
eck00052  Galactose metabolism
eck00500  Starch and sucrose metabolism
eck00520  Amino sugar and nucleotide sugar metabolism
eck00521  Streptomycin biosynthesis
eck01100  Metabolic pathways
eck01110  Biosynthesis of secondary metabolites
eck01120  Microbial metabolism in diverse environments
eck01130  Biosynthesis of antibiotics
eck01200  Carbon metabolism
Module
eck_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eck_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eck00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EC55989_2684 (glk)
   00052 Galactose metabolism
    EC55989_2684 (glk)
   00500 Starch and sucrose metabolism
    EC55989_2684 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    EC55989_2684 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    EC55989_2684 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    EC55989_2684 (glk)
Enzymes [BR:eck01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     EC55989_2684 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: CAU98549
UniProt: B7LCE0
Structure
PDB: 

Position
complement(2740840..2741805)
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVIRVYLEEHKVEVKDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFG
GAEPVEGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEAIILEILRAE
IGHVSAERVLSGPGLVNLYRAIVKADNRLPENLKPKDITERALADSCTDCRRALSLFCVI
MGRFGGNLALNLGTFGGVFIAGGIVPRFLEFFKASGFRAAFEDKGRFKEYVHDIPVYLIV
HDNPGLLGSGAHLRQTLGHIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgcattagtcggtgatgtgggcggcaccaacgcacgtcttgctctgtgt
gatattgccagtggtgaaatctcgcaggctaagacctattcagggcttgattaccccagc
ctcgaagcggtcattcgcgtttatcttgaagaacataaggtcgaggtgaaagacggctgt
attgccatcgcttgcccaattaccggtgactgggtggcaatgaccaaccatacctgggcg
ttctcaattgccgaaatgaaaaagaatctcggttttagccatctggaaattattaacgat
tttaccgctgtatcaatggcgatcccgatgctgaaaaaagagcatctgattcagtttggt
ggcgcagaaccggtagaaggtaaacctattgcggtttacggtgccggaacagggcttggg
gttgcgcatctggtccatgtcgataagcgttgggtaagcttgccgggcgaaggcggtcac
gttgattttgcgccgaatagtgaagaagaggccattatcctcgaaatattgcgtgcggaa
attggtcatgtttcggcggagcgcgtgctttctggccctgggctggtgaatttgtatcgc
gcaattgtgaaagctgacaaccgcctgccagaaaatctcaagccaaaagatattaccgaa
cgcgcgctggctgacagctgcaccgattgccgccgcgcattgtcgctgttttgcgtcatt
atgggccgttttggcggcaatctggcgctcaatctcgggacatttggcggcgtgtttatt
gcgggcggtatcgtgccgcgcttccttgagttcttcaaagcctctggtttccgtgccgca
tttgaagataaagggcgctttaaagaatatgtccatgatattccggtgtatctcatcgtc
catgacaatccgggtcttctcggttccggtgcacatttacgccagaccttaggtcacatt
ctgtaa

DBGET integrated database retrieval system