KEGG   Escherichia coli 55989 (EAEC): EC55989_2803Help
Entry
EC55989_2803      CDS       T00826                                 

Gene name
ndk
Definition
(GenBank) multifunctional nucleoside diphosphate kinase and apyrimidinic endonuclease and 3'-phosphodiesterase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
eck  Escherichia coli 55989 (EAEC)
Pathway
eck00230  Purine metabolism
eck00240  Pyrimidine metabolism
eck01100  Metabolic pathways
eck01110  Biosynthesis of secondary metabolites
eck01130  Biosynthesis of antibiotics
Module
eck_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
eck_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
eck_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
eck_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:eck00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EC55989_2803 (ndk)
   00240 Pyrimidine metabolism
    EC55989_2803 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eck04131]
    EC55989_2803 (ndk)
Enzymes [BR:eck01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     EC55989_2803 (ndk)
Membrane trafficking [BR:eck04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    EC55989_2803 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: CAU98676
UniProt: B7LDB0
Structure
PDB: 

Position
complement(2868293..2868724)
Genome map
AA seq 143 aa AA seqDB search
MAIERTFSIIKPNAVAKNVIGNIFARFEAAGFKIVGTKMLHLTVEQARGFYAEHDGKPFF
DGLVEFMTSGPIVVSVLEGENAVQRHRDLLGATNPANALAGTLRADYADSLTENGTHGSD
SVESAAREIAYFFGEGEVCPRTR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggctattgaacgtactttttccatcatcaaaccgaacgcggtagcaaaaaacgtcatt
ggtaatatctttgcgcgctttgaagctgcagggttcaaaattgtcggcaccaaaatgctg
cacctgaccgttgaacaggcacgtggcttttatgctgaacacgatggaaaaccgttcttt
gatggtctggttgaattcatgacctctggcccgatcgtggtttccgtgctggaaggtgaa
aacgccgttcagcgtcaccgcgatctgctgggcgcgaccaatccggcaaacgcactggct
ggtactctgcgcgctgattacgctgacagcctgaccgaaaacggtacccacggttctgat
tccgtcgaatctgccgctcgcgaaatcgcttatttctttggcgaaggcgaagtgtgcccg
cgcacccgttaa

DBGET integrated database retrieval system