KEGG   Escherichia coli 55989 (EAEC): EC55989_3153
Entry
EC55989_3153      CDS       T00826                                 

Gene name
xdhA
Definition
(GenBank) xanthine dehydrogenase, molybdenum binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
eck  Escherichia coli 55989 (EAEC)
Pathway
eck00230  Purine metabolism
eck01100  Metabolic pathways
eck01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eck00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EC55989_3153 (xdhA)
Enzymes [BR:eck01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     EC55989_3153 (xdhA)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: CAU99094
UniProt: B7LF45
Position
3224486..3226744
AA seq 752 aa
MRVDAIAKVTGRARYTDDYVMAGMCYAKYVRSPIAHGYAVSINDEQARSLPGVLAIFTWE
DVPDIPFATAGHAWTLDENKRDTADRALLTRHVRHHGDAVAIVVARDELTAEKAAQLVSI
EWQELPVITTPEAALAEDAAPIHNGGNLLKQSTMSTGNVQQTIDAADYQVQGHYQTPVIQ
HCHMESVTSLAWMEDDSRITIVSSTQIPHIVRRVVGQALDIPWSCVRVIKPFVGGGFGNK
QDVLEEPMAAFLTSKLGGIPVKVSLSREECFLATRTRHAFTIDGQMGVNRDGTLKGYSLD
VLSNTGAYASHGHSIASAGGNKVAYLYPRCAYAYSSKTCYTNLPSAGAMRGYGAPQVVFA
VESMLDDAATALGIDPVEIRLRNAAREGDANPLTGKRIYSAGLPECLEKGRKIFEWEKRR
AECQNQQGNLRRGVGVACFSYTSNTWPVGVEIAGARLLMNQDGTINVQSGATEIGQGADT
VFSQMVAETVGVPVSDVRVISTQDTDVTPFDPGAFASRQSYVAAPALRSAALLLKEKIIA
HAAVMLHQSAMNLTLIKGHIVLVERPEEPLMSLKDLAMDAFYHPERGGQLSAESSIKTTT
NPPAFGCTFVDLTVDIALCKVTINRILNVHDSGHILNPLLAEGQVHGGMGMGIGWALFEE
MIIDAKSGVVRNPNLLDYKMPTMPDLPQLESAFVEINEPQSAYGHKSLGEPPIIPVAAAI
RNAVKMATGVAINTLPLTPKRLYEEFHLAGLI
NT seq 2259 nt   +upstreamnt  +downstreamnt
atgcgcgtcgatgccattgctaaggtcaccgggcgggcacgatatactgacgattatgtt
atggcgggcatgtgttatgcgaaatatgtacgtagccctatcgcacatggttatgccgta
agtattaatgatgaacaagccagaagtttgccgggcgtactggcgatttttacctgggaa
gatgtgcctgatattccatttgctactgctgggcatgcctggacacttgacgaaaacaag
cgcgataccgccgatcgcgcactgctaactcgccatgttcgtcatcatggtgacgccgtt
gccatcgtcgtggcccgcgatgaactcacggcagaaaaagcggcgcaattggtcagcatt
gagtggcaagaattacccgttatcaccacgccagaagcggcgctggcagaagacgctgca
ccaatccataacggtggcaatttactgaaacaaagcacgatgtcgacgggtaatgtccaa
caaacaatcgatgccgccgactaccaggtacaggggcactatcagacccccgttattcaa
cattgtcacatggaaagcgtaacatcgctggcgtggatggaggatgactcgcgaattacc
atcgtttccagcacccagatcccgcacattgttcgccgcgtggttggtcaggcgctggat
attccctggtcatgcgtacgagtcatcaaaccgtttgtcggtggcggttttggtaataaa
caggatgtactggaagagccaatggcggcattcctgaccagcaagcttggcggcattccg
gtgaaagtttcccttagccgtgaagagtgtttcctcgcaacccgtacccgccacgctttt
accattgacgggcaaatgggcgtgaaccgcgacggaacattgaaaggttatagtctggat
gttctgtctaacaccggcgcttatgcatctcacgggcactccatcgcttctgcggggggg
aataaagtcgcttacctttatcctcgttgtgcctacgcttacagttcaaagacctgctat
accaacctcccctcggctggtgcgatgcgtggttatggcgcgccacaagtcgtatttgcc
gttgagtctatgcttgatgacgccgcgacagcgttaggtattgatcctgttgaaattcgt
ttacgcaacgccgcccgcgaaggagatgctaatccgctcacgggcaaacgtatttacagc
gcagggttgccggagtgtcttgaaaaaggccggaaaatctttgaatgggaaaaacgccgt
gcagaatgccagaaccagcaaggcaatttgcgccgcggcgttggcgtcgcctgttttagc
tacacctctaacacctggcctgtcggcgtagaaatagcaggcgcgcgccttctgatgaat
caggatggaaccatcaacgtgcaaagcggcgcgacggaaatcggtcagggtgccgacacc
gtcttctcgcaaatggtggcagaaaccgtgggggttccggtcagcgacgttcgcgttatt
tcaactcaagataccgacgttacgccgttcgatcccggcgcatttgcctcacgccagagc
tatgttgccgcgcctgcgctgcgcagtgcggcactattattaaaagagaaaatcatcgct
cacgccgcagtcatgctacatcagtcagcgatgaatctgaccctgataaaaggccatatc
gtgctggttgaacgaccggaagagccgttaatgtcgttaaaagatttggcgatggacgct
ttctaccaccctgaacgcggcgggcagctctctgctgaaagctccatcaaaaccaccact
aacccaccggcgtttggctgtacctttgttgatctgacggtcgatattgcgctgtgcaaa
gtcaccatcaaccgcatcctcaacgttcatgattcagggcatattcttaatccactgctg
gcagaaggtcaggtacacggcggaatgggaatgggcattggctgggcgctatttgaagag
atgatcatcgatgctaaaagcggcgtggtccgtaaccccaatctgctggattacaaaatg
ccgaccatgccggatctgccacaactggaaagcgcgttcgtcgaaatcaatgagccgcaa
tccgcatacggacataagtcactgggtgagccaccaataattcctgttgccgctgctatt
cgtaacgcggtgaagatggctaccggtgttgcaatcaatacactgccgctgacgccaaaa
cggttatatgaagagttccatctggcaggattgatttga

DBGET integrated database retrieval system